Sequence:
download
CN06574sequence.fasta
>Cbn-LEV-10 MRKCDQHFDETQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQVWKNDTNFFFQIDSAHFFAISPHAPQNCKNGRSQHF GQWPQKPIFLQCVYTFVAGPRQRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLR HVMKIVLHSRSTNHEENHGFRAKYSFIPEDKFIAGEPVSGRKCSYIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAYR GERIRLFFTDFDIFFGGEHCPYDSITIFDGPTPSSPIIRKVCGLQQRMEIYSMSNSLLIHFNTTHPAKSDPRGFIMDYEF SSRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETTHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVL SFDTSPATAPPSVDDIACPSAWVGIAIGEGNMKAVMSSTDDSIFDVTLCERIPSDSPLLGPYISEGPRMVMQFGSTDTRD DKITPIGFKATIEFKTDFGVTGESLGTSNECRFRFTSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSG DNDNNCNDYLDVYDVFVKNGKEELRLKERYCSDTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPHG EAHIRRGAYRCGSVINSTSQKPNGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSDSASCQKAVIRV QGAPRTEYCGTKREFFEAYLSPSNSVSISFLTAPDKVNGLKGFNLSWTEVKNLSGKDESVCKSDSLYLCTYSKLCIDAKL RCNGLDNCGYGVQDDTDEQHCSLKEKTADRTVVIAAIFCGGIFVFICGFFLYLFKKKLERKKKSKRKNDTKHRQRQPYRQ QKPMHKQNFDSQLSPPATSRFVHHDATGIMPPIPLHQIGHRDLYS
view sequence (925 aa)
>Cbn-LEV-10
MRKCDQHFDETQPEGVIEFPSLPKQLALSHGVNNSKPEQQYNLQVWKNDTNFFFQIDSAHFFAISPHAPQNCKNGRSQHF
GQWPQKPIFLQCVYTFVAGPRQRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILSSALGGRYCGTVAPHVRISLR
HVMKIVLHSRSTNHEENHGFRAKYSFIPEDKFIAGEPVSGRKCSYIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKAYR
GERIRLFFTDFDIFFGGEHCPYDSITIFDGPTPSSPIIRKVCGLQQRMEIYSMSNSLLIHFNTTHPAKSDPRGFIMDYEF
SSRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETTHTISSPNYPEVYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVL
SFDTSPATAPPSVDDIACPSAWVGIAIGEGNMKAVMSSTDDSIFDVTLCERIPSDSPLLGPYISEGPRMVMQFGSTDTRD
DKITPIGFKATIEFKTDFGVTGESLGTSNECRFRFTSSTGFFNSPRYPANYPLDTNCTYYIVGQPGKEILLHFEQFALSG
DNDNNCNDYLDVYDVFVKNGKEELRLKERYCSDTFPGPSVSAFGSHEMRVVFTSGSSGTANGFKALFEIRTARKEDVPHG
EAHIRRGAYRCGSVINSTSQKPNGLIISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSDSASCQKAVIRV
QGAPRTEYCGTKREFFEAYLSPSNSVSISFLTAPDKVNGLKGFNLSWTEVKNLSGKDESVCKSDSLYLCTYSKLCIDAKL
RCNGLDNCGYGVQDDTDEQHCSLKEKTADRTVVIAAIFCGGIFVFICGFFLYLFKKKLERKKKSKRKNDTKHRQRQPYRQ
QKPMHKQNFDSQLSPPATSRFVHHDATGIMPPIPLHQIGHRDLYS
Estimated Isoelectric Point:
6.68709564208984
Estimated Molecular Weight:
104.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr54
Lys54
Gln35
Leu56
Gly63
Met16
Ser84
Tyr38
His31
Glu51
Arg49
Cys29
Phe56
Pro53
Val53
Asn43
Ala40
Ile58
Trp5
Asp57