Sequence:
download
CN05105sequence.fasta
>Cbn-RHEB-1 MTTSLHSNRQSLNRKVAVMGYPHVGKSAIVLRFTQNVFPERYESTIEDQHSKYMTAFQRDYHVRVTDTAGQQEYTVFPRS CSFDINGFVLVYAIDDRKSFEMCTSIYEKIVKTYGDTSLPIVIVGNKNDLTTQRVVQHAEGTQLAKKWNAKFLEITAKES NRVSEVFEVLLREIEISRGNVLPTDRQNAPKSPSPAPSRPDPKGCIIS
view sequence (208 aa)
>Cbn-RHEB-1
MTTSLHSNRQSLNRKVAVMGYPHVGKSAIVLRFTQNVFPERYESTIEDQHSKYMTAFQRDYHVRVTDTAGQQEYTVFPRS
CSFDINGFVLVYAIDDRKSFEMCTSIYEKIVKTYGDTSLPIVIVGNKNDLTTQRVVQHAEGTQLAKKWNAKFLEITAKES
NRVSEVFEVLLREIEISRGNVLPTDRQNAPKSPSPAPSRPDPKGCIIS
Estimated Isoelectric Point:
8.92607879638672
Estimated Molecular Weight:
23.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr16
Lys13
Gln10
Leu11
Gly9
Met4
Ser18
Tyr8
His5
Glu13
Arg14
Cys3
Phe9
Pro11
Val19
Asn10
Ala11
Ile13
Trp1
Asp10