Sequence:
download
CN02059sequence.fasta
>Cbn-GPA-13 MGCNFSSQGKLQVPEIRASRSITPASQKSDDNSYSHIRLLLLGSAESGKTTVLEQVRLLYKQHFKESEYFHRRAFIYHNI FKCIKALCRAMKISDIEFSDPINAGRAQSIIADEENHYGLFSKEMAEKIKAIWNDKSMQKLYALRSQFNLNDSASYFLNN LDKINTVEYKPSDRDLIMAYVPTCGVQNVVFTANNQSFQLFDIGGQKIDRRKWATQYEGIDAIFFCLAISEYDQVMSEDM VSNRLDDALGLLQKISEEPMFATTPIYLFLNEVDVFCEKLDVIPLSKYKPDFKGGDQDDAIDFMENLAVTALGKRDKSLY RIYRCIAIDTQMMAELLSTVFKDIMKRKR
view sequence (349 aa)
>Cbn-GPA-13
MGCNFSSQGKLQVPEIRASRSITPASQKSDDNSYSHIRLLLLGSAESGKTTVLEQVRLLYKQHFKESEYFHRRAFIYHNI
FKCIKALCRAMKISDIEFSDPINAGRAQSIIADEENHYGLFSKEMAEKIKAIWNDKSMQKLYALRSQFNLNDSASYFLNN
LDKINTVEYKPSDRDLIMAYVPTCGVQNVVFTANNQSFQLFDIGGQKIDRRKWATQYEGIDAIFFCLAISEYDQVMSEDM
VSNRLDDALGLLQKISEEPMFATTPIYLFLNEVDVFCEKLDVIPLSKYKPDFKGGDQDDAIDFMENLAVTALGKRDKSLY
RIYRCIAIDTQMMAELLSTVFKDIMKRKR
Estimated Isoelectric Point:
6.26476287841797
Estimated Molecular Weight:
40.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr12
Lys27
Gln17
Leu31
Gly14
Met12
Ser28
Tyr15
His5
Glu20
Arg18
Cys7
Phe20
Pro9
Val15
Asn17
Ala25
Ile28
Trp2
Asp27