Sequence:
download
CN01902sequence.fasta
>Cbn-PEB-1 MLSLEKPGSSDISSSSTDTSAISPISVSSMPLSPDKEKKKISFIPYNPNIPQIVTSFKGYQKLMYQGYRYNIYQVVPEKN FKSWRCVCAKKMPDDGQWCKCRAETSIDNSNATTKGNHNHPPKHHVAEIEFIKSQLLVAAFENPDHDAGDLVNQASMYLS EGVCFDNKESIKKSLISARNKEGKPKKPRTNKIASSPLKRMKVETTDDEEENIKIPKMEFLPFFNNGLSMVKVEPHFNQT PTIQIPQPAPLPAPQPQEQSSLLQPAPFNNSTNWMGLEDPVALFWANAMFNPMSQLDVLSTLAALSKQPQGPTPGATAPT TAPLSSNLSVSSFTPQMPKEASIAAPPPQILNLKDLKPLPPLTTIQTSPVIQSANLLRPIPMMRDSCTQTTKEIKVSQCL TSGCGCRVIRICCCDEGVCRRTAAC
view sequence (425 aa)
>Cbn-PEB-1
MLSLEKPGSSDISSSSTDTSAISPISVSSMPLSPDKEKKKISFIPYNPNIPQIVTSFKGYQKLMYQGYRYNIYQVVPEKN
FKSWRCVCAKKMPDDGQWCKCRAETSIDNSNATTKGNHNHPPKHHVAEIEFIKSQLLVAAFENPDHDAGDLVNQASMYLS
EGVCFDNKESIKKSLISARNKEGKPKKPRTNKIASSPLKRMKVETTDDEEENIKIPKMEFLPFFNNGLSMVKVEPHFNQT
PTIQIPQPAPLPAPQPQEQSSLLQPAPFNNSTNWMGLEDPVALFWANAMFNPMSQLDVLSTLAALSKQPQGPTPGATAPT
TAPLSSNLSVSSFTPQMPKEASIAAPPPQILNLKDLKPLPPLTTIQTSPVIQSANLLRPIPMMRDSCTQTTKEIKVSQCL
TSGCGCRVIRICCCDEGVCRRTAAC
Estimated Isoelectric Point:
8.73360443115234
Estimated Molecular Weight:
46.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys34
Gln23
Leu31
Gly15
Met14
Ser44
Tyr7
His6
Glu21
Arg12
Cys14
Phe14
Pro45
Val19
Asn25
Ala28
Ile26
Trp4
Asp17