Sequence:
download
CN01635sequence.fasta
>Cbn-MRG-1 MAETNKAPPTPKFRVGEEIAAMHTNAIYPATVKEIKEHKGELKYLIHFTGWNRRYDERIPVGKEAGKMFAKDAAPRDAVV EPHLLMKKSAKMREGGSVNGDATTPVPPKKGPKTRFTVPSPPPILVDHEEGSSAKVDIPNQNPLSHIKEPTSIVNLPQSL RKILVDDFELINRGYLVKESSAKNNIDQIITDYIKTIAVGDKDLTQEHSDITHENGKETRSTNVGMVLAARGLLDYFNAT IGYQMLYRGERSQYNDLVARVLVDSEGHKRGQVPLPDEQFRASNYYGIIHLVRMLARIEDLLKMSSWNDFLQGRIMSGVD DLLGFLDKNLKKYYKGAAEYMTADTDYHTRILAKNDDEPGTSSN
view sequence (364 aa)
>Cbn-MRG-1
MAETNKAPPTPKFRVGEEIAAMHTNAIYPATVKEIKEHKGELKYLIHFTGWNRRYDERIPVGKEAGKMFAKDAAPRDAVV
EPHLLMKKSAKMREGGSVNGDATTPVPPKKGPKTRFTVPSPPPILVDHEEGSSAKVDIPNQNPLSHIKEPTSIVNLPQSL
RKILVDDFELINRGYLVKESSAKNNIDQIITDYIKTIAVGDKDLTQEHSDITHENGKETRSTNVGMVLAARGLLDYFNAT
IGYQMLYRGERSQYNDLVARVLVDSEGHKRGQVPLPDEQFRASNYYGIIHLVRMLARIEDLLKMSSWNDFLQGRIMSGVD
DLLGFLDKNLKKYYKGAAEYMTADTDYHTRILAKNDDEPGTSSN
Estimated Isoelectric Point:
7.20075225830078
Estimated Molecular Weight:
40.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr21
Lys30
Gln9
Leu29
Gly25
Met11
Ser20
Tyr15
His11
Glu24
Arg20
Phe9
Pro22
Val22
Asn19
Ala26
Ile23
Trp2
Asp26