Sequence:
download
CN01502sequence.fasta
>Cbn-RNP-3 MADISPNHTVYVNNLNEKIKKDELKRSLHMIFTQFGEIIQLMSFRKEKMRGQAHVVFKEVSSASNALRALQLSPPNLKFS ISGLPVYGKPDANQYAREDSDVIARAKGTFVEKRQKSVGGANKQKKPYERPAKSSTAGEKNDQEKSKEEDSEGPGAPNNI LFCSNIPDGTDPEQIQTIFSQCVIFREKVA
view sequence (190 aa)
>Cbn-RNP-3
MADISPNHTVYVNNLNEKIKKDELKRSLHMIFTQFGEIIQLMSFRKEKMRGQAHVVFKEVSSASNALRALQLSPPNLKFS
ISGLPVYGKPDANQYAREDSDVIARAKGTFVEKRQKSVGGANKQKKPYERPAKSSTAGEKNDQEKSKEEDSEGPGAPNNI
LFCSNIPDGTDPEQIQTIFSQCVIFREKVA
Estimated Isoelectric Point:
9.12944793701172
Estimated Molecular Weight:
21.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr6
Lys20
Gln11
Leu10
Gly11
Met4
Ser17
Tyr4
His3
Glu15
Arg9
Cys2
Phe9
Pro11
Val11
Asn12
Ala14
Ile12
Asp9