Sequence:
download
CN00272sequence.fasta
>Cbn-LIN-42 MIISTSTCPLFFFCSATTTTTLLLLLHSLLQLTFRARAASCQRGTISQMEPAGHSSATHNIVVPNANPPQQQQLAPTSGM REEGATLSPPNTWSSSSVEFLDDSDDNRLLFTCTFTLPNGCVLSSSGYADGFNEQYLPAGTNFLTRLEPKGQSFILSAAA ASVKQRIFARVIMPDGALRACELLCEFETERAKITVLALRSAFNVQASTHLSSNFHVFTFITKHSSTCALTHIDYASIPY LGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAHNGSILRCQTEWSAYVNPWTRKMELVVARH RICSLPIGDADVISAPPAGVQSNTLPPVMAKTFEDELRTIMNKPVPSTSRHSSSHHQLKEQTQLMQLAGFNTTDLGAYID KIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKAVSAPPTTSTDPPLSYTQINCLENVHRLLKSQSRPESPA KQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPPAKQCRQSAAPLHWSSAPNQKTDYYRTM APAPPPPPGKNYQITYTPLDDPTDQKSTNTKSDVENLMYPVSGSKFSTPMRLSIDGGASTPPPQAMQRLLLPRAATSTGG ASPTSGSNSPPAFPKTSSSSSLLMLRDSQN
view sequence (670 aa)
>Cbn-LIN-42
MIISTSTCPLFFFCSATTTTTLLLLLHSLLQLTFRARAASCQRGTISQMEPAGHSSATHNIVVPNANPPQQQQLAPTSGM
REEGATLSPPNTWSSSSVEFLDDSDDNRLLFTCTFTLPNGCVLSSSGYADGFNEQYLPAGTNFLTRLEPKGQSFILSAAA
ASVKQRIFARVIMPDGALRACELLCEFETERAKITVLALRSAFNVQASTHLSSNFHVFTFITKHSSTCALTHIDYASIPY
LGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAHNGSILRCQTEWSAYVNPWTRKMELVVARH
RICSLPIGDADVISAPPAGVQSNTLPPVMAKTFEDELRTIMNKPVPSTSRHSSSHHQLKEQTQLMQLAGFNTTDLGAYID
KIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKAVSAPPTTSTDPPLSYTQINCLENVHRLLKSQSRPESPA
KQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPPAKQCRQSAAPLHWSSAPNQKTDYYRTM
APAPPPPPGKNYQITYTPLDDPTDQKSTNTKSDVENLMYPVSGSKFSTPMRLSIDGGASTPPPQAMQRLLLPRAATSTGG
ASPTSGSNSPPAFPKTSSSSSLLMLRDSQN
Estimated Isoelectric Point:
8.75518035888672
Estimated Molecular Weight:
73.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr59
Lys28
Gln38
Leu65
Gly25
Met13
Ser73
Tyr15
His18
Glu24
Arg34
Cys13
Phe23
Pro56
Val34
Asn25
Ala66
Ile26
Trp5
Asp30