Sequence:
download
CE54486sequence.fasta
>W05F2.4, isoform m MPSVENDDDDGFYDNIGIYNDDRRYSRGSELETSASFRQLPPASNTSKHNRIGSFLRKIGGGSSRPPGSAASLMSLNKIA NETIIKPGGLMKSNSLSNEPWKKVMLNGGASMPREANNNHKTGLGARLKNSLFGSRKRLDG
view sequence (141 aa)
>W05F2.4, isoform m
MPSVENDDDDGFYDNIGIYNDDRRYSRGSELETSASFRQLPPASNTSKHNRIGSFLRKIGGGSSRPPGSAASLMSLNKIA
NETIIKPGGLMKSNSLSNEPWKKVMLNGGASMPREANNNHKTGLGARLKNSLFGSRKRLDG
Estimated Isoelectric Point:
9.92102813720703
Estimated Molecular Weight:
15.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr4
Lys10
Gln1
Leu12
Gly16
Met5
Ser19
Tyr3
His2
Glu6
Arg11
Phe4
Pro8
Val2
Asn14
Ala8
Ile7
Trp1
Asp8