Sequence:
download
CE54177sequence.fasta
>SNF-6 MSVSSNDPEQRNGRGMASGNNVDMSLYPPFIKQLDAKLPDYTREGDIEYPFEEITGVGDENRIRGNWSNKSDYLLAVIGF TAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFF NIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKY FHNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFL TPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAIS LDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLRRNRRHVLTTVCALF ILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWKILFKFICPMVYLA ILCFLWLDWNSIQYESYQFPYWSILTAWCIASFPLILIPIVGIWQFCIAKGTITQKWWRVLYPDDAWGPAMAIHRAEKFP LQIPEARRLLLPPEVEIASSRGVLQEEMPMSYDYNTSSAADVRSNRSTGHGATDVRSVAATNNTIPKFERETAI
view sequence (714 aa)
>SNF-6
MSVSSNDPEQRNGRGMASGNNVDMSLYPPFIKQLDAKLPDYTREGDIEYPFEEITGVGDENRIRGNWSNKSDYLLAVIGF
TAGVGSFWKFPFLVFQHGGAAFLVPYLCMLCLASLPMFFMEMVLGQFSSSAAISVWKVVPLFKGIGFAQVTISGFFAVFF
NIISAWTLFYLINSFSFSIPWSNCANSWSGENCTLGTRIQCKEMNGTLLVNGSCIVEHASSNETTVIPLHDLGSIPSLKY
FHNDVLMLSKGVDDFGTLNWYLGLCVLACWIAVFLCLFQGVKSSGKVVYVAVIVPFIILTVLLTRLLTLDGSLAAVFYFL
TPKWEILMDLHVWGEAAVQAFYSVSCCSGGLFTIASYSRFHNNIYKDIWLVLIVDVIVSLVGCLLTFSAIGFTCYEFAIS
LDKFHIRDGFHLVFVFLAEALAGVSVAPLYAGLFFIMILLVVHATQMFVVETIVSSICDEYPERLRRNRRHVLTTVCALF
ILLSIPFCLSSGLFWMELLTQFVLTWPLVVIAFLECMAINWVYGVDNMLDNAKWIVGYWPPCYIFWKILFKFICPMVYLA
ILCFLWLDWNSIQYESYQFPYWSILTAWCIASFPLILIPIVGIWQFCIAKGTITQKWWRVLYPDDAWGPAMAIHRAEKFP
LQIPEARRLLLPPEVEIASSRGVLQEEMPMSYDYNTSSAADVRSNRSTGHGATDVRSVAATNNTIPKFERETAI
Estimated Isoelectric Point:
5.60509490966797
Estimated Molecular Weight:
80.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr33
Lys21
Gln16
Leu80
Gly44
Met19
Ser56
Tyr26
His12
Glu29
Arg23
Cys22
Phe54
Pro32
Val61
Asn28
Ala51
Ile56
Trp25
Asp26