Sequence:
download
CE54125sequence.fasta
>ACR-5 MLPNIILILLIRYCSCGAGSRVYEKYGKQVQLSPATTSSYREWYDSNREHSTRNNTNVDDFQTQLKKSLENTTAAYNATF MQELIEERQRYLEKLNEGQFINDQRRLVEELLDPNYYEKTVHPKRDYTRPTRVNLSMSLYQILDVDEHMQSIEVNVWMVQ HWYDEFLDWNPVDYGMINRTIVPYHQIWIPDTYLYNSEELEQKKTESLMNAQLETGHWNQKKDGAKVQLMFPAIYKLSCR MDVRWFPYDRQNCTFIISSWTHDKQTIDYWPLSSTVNLGNMARNDEWEVISFEFVRVEETFKCCTAPWVMLYAHLVIRRK PLYYMINLVVPTSIITIVAVTGFFTPTSSSSERDEKLYLGINTLLTMSVMMLMVCNQMPSTSTYVPLMSWYYIGIIMVIV VGTFLATGVLAIHGQKHYNKPISDRIRKLIYNPVVEFFILSPPTSLIDLWTEFGVISEQRHSTHLDPLLLQHMDPISHTT RADPQHFFGSISSQMCDLQSTYSYTARLATITRQYTQHAKMKALRKNQYRMSMDTSQARGVKKQKMQRRCSLEWEFLANV LDRILLTIFCGFTFAVFIILIGFDSFFTFHTDSPPKTM
view sequence (598 aa)
>ACR-5
MLPNIILILLIRYCSCGAGSRVYEKYGKQVQLSPATTSSYREWYDSNREHSTRNNTNVDDFQTQLKKSLENTTAAYNATF
MQELIEERQRYLEKLNEGQFINDQRRLVEELLDPNYYEKTVHPKRDYTRPTRVNLSMSLYQILDVDEHMQSIEVNVWMVQ
HWYDEFLDWNPVDYGMINRTIVPYHQIWIPDTYLYNSEELEQKKTESLMNAQLETGHWNQKKDGAKVQLMFPAIYKLSCR
MDVRWFPYDRQNCTFIISSWTHDKQTIDYWPLSSTVNLGNMARNDEWEVISFEFVRVEETFKCCTAPWVMLYAHLVIRRK
PLYYMINLVVPTSIITIVAVTGFFTPTSSSSERDEKLYLGINTLLTMSVMMLMVCNQMPSTSTYVPLMSWYYIGIIMVIV
VGTFLATGVLAIHGQKHYNKPISDRIRKLIYNPVVEFFILSPPTSLIDLWTEFGVISEQRHSTHLDPLLLQHMDPISHTT
RADPQHFFGSISSQMCDLQSTYSYTARLATITRQYTQHAKMKALRKNQYRMSMDTSQARGVKKQKMQRRCSLEWEFLANV
LDRILLTIFCGFTFAVFIILIGFDSFFTFHTDSPPKTM
Estimated Isoelectric Point:
6.98777008056641
Estimated Molecular Weight:
70.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr48
Lys27
Gln31
Leu54
Gly19
Met26
Ser44
Tyr32
His17
Glu32
Arg33
Cys10
Phe27
Pro26
Val37
Asn28
Ala22
Ile42
Trp14
Asp29