Sequence:
download
CE53988sequence.fasta
>UNC-52, isoform d MAFSLFSVVSLTVIYRLTINFPELPYTQELKNVESDEFVSTSRDIAHSIQELVKDLEGRHTAKVADYKYHKIIGSLVYVD LYAEKESPLVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSIACATTEFTCLDKSCIPADQRCDGRRNCPDGSDEHKEH GKCKQHQPIIHQTEKVVFAQKHGSIHLSASIDSSVEDNKIAWSKDSVLLGVGSMTLAEDGRVTVYKKGDKHHLHIINATD ADDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQCPDGDDEEHCSEVQCKSNEFR CESTNVCVPTVVVCDGWKDCHDGSDEKKCSHPRKTYKPHHVHHVKVNAVCQDGSEPEFSLHGSSYCWSNKVCPAMTECVA GLCCSISKTRKRQSECLEGQFKCGTGQCIEESLKCNRKYDCADGSDEITCEYYLAVQKYHVEQQRQETQQSSAAAPTRAS AAPAAPASMEHQSDNLVCNDQEFRCPYLAETRCFHYDRLCDGTDDCGDGSDETNCDSNEADQPAAPIPPPVPAPDSVEED VSRCSSVQFECKRDGKCIDKALECNHKYDCEDGSDETECEYFKAAMARRGESTSTSTTTTEQQHQRQHHQAQQAQQHQQQ QERQQQERQQHERQQQERQQQDRQQQAQQHHQAQQHHSQQHPAQPAQPSQDHHEEHRRRLEEHRRREEEHHRRQEEESRA RALQQSLLHASQVESTEVTFQDEYDGDSGVGCLEHEFQCAIGECIDKRRVCDTRPDCLDASDEQNCADRAPAPLPTHSQQ HHHVAQPAAPPSLPSVNTYPDQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSS AHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGE PDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSF HCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTI HDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNC DQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDAACDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLT FDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVET YETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED CAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVT QQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTSYGG TLEYTFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLADLDTLLIK STYNDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKE YGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYY GDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPH EGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQY GTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPSGVQEQQGILHIPRASDQEVG QYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGIL ERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFV KRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPIIDPAEQTVPEGSPFKIRCYV PGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPATVHVTNAAAPPQVEARPPQHP VITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQDAGEYVCLYSPENSPPVKTN PSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVNQDGDDIVISEAGDRNVGEYV CSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPNGSPLPHDVTPLEPNILD FSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPE RGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKGELICT ATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSANADDEPKVEIEPP RVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVYRCNVEDNNGLVIGSAFTAVS VGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEG FVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDLKEDNAGVYRC VAKTKAGPLQTRTVLNVGSGKQDQVTFTVADSLPVVYTVGQPAYLSCIGKTETKPNQSVVWTKEEGDLPSGSRVEQGVLM LPSVHRDDEGSYTCEIVKEENPVFSTVDLQIDDFIPVIDGEPIELPPLSDEEIVNLDIEITLNTANPKGIIFETKRINSG DLLATPYDTIHHEAKITDYGTVLYEFDIGNGRQIVETTNPINPNEWNVIKIKNDKNQVTIQLNDESATIRQHTNPLPSLS TGVNRPVFIGGRHEPTNEANDFRGIISQVVLSGHNVGLGDARIPSSVVKYDACASTNLCLNGANCRNANNHHGFSCECAE EFHGEYCQWRSNSCHDESCNTGICLDNEESWQCVCPLGTTGLRCEEKTEIPQPLGFTSDTSFLAVKRPVKFESIKMKLRP QADSDEHILMYFASDYGSNTKQYTSLSLIANQVVLTVRRPDKEVQKIRSETLEAGELIDVAVRQAGNALVMTVDGNQVST IETDTLKPGTEIFIGGLPPGLNSPDDVVEQSFQGCVYEILINSQDVDLQNLSSSGDISSCEESQFPVEEDDTTTTTTTEE PEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEPTTTTEEPTTTTTEEPYHIYETSRDDDPEIIIPVETTTTST TTTSTTEEPEAEPALVLPTDPVEENDVSDEEEEISTISTVSPDNGLDSDSDYSEGTLPPDSSSEEIVVGDVYSTQEPNNI CANSTCGMNGQCVPRNMTHYTCECKLYYDGPTCSLFKPIEHAARFDGDAFIELSSDEFPHLTSEKDEIVAFKFKTEQQNG VLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHLISEERVDDGKEHSVRFERKGREGQMRIDNYREVDGRSTGI LAMLNVDGNIFVGGVPDISKATGGLFSNNFVGCIADVELNGVKLDLMATAIDGKNVKPCDEWMHRKRWLYRRRVR
view sequence (4075 aa)
>UNC-52, isoform d
MAFSLFSVVSLTVIYRLTINFPELPYTQELKNVESDEFVSTSRDIAHSIQELVKDLEGRHTAKVADYKYHKIIGSLVYVD
LYAEKESPLVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSIACATTEFTCLDKSCIPADQRCDGRRNCPDGSDEHKEH
GKCKQHQPIIHQTEKVVFAQKHGSIHLSASIDSSVEDNKIAWSKDSVLLGVGSMTLAEDGRVTVYKKGDKHHLHIINATD
ADDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQCPDGDDEEHCSEVQCKSNEFR
CESTNVCVPTVVVCDGWKDCHDGSDEKKCSHPRKTYKPHHVHHVKVNAVCQDGSEPEFSLHGSSYCWSNKVCPAMTECVA
GLCCSISKTRKRQSECLEGQFKCGTGQCIEESLKCNRKYDCADGSDEITCEYYLAVQKYHVEQQRQETQQSSAAAPTRAS
AAPAAPASMEHQSDNLVCNDQEFRCPYLAETRCFHYDRLCDGTDDCGDGSDETNCDSNEADQPAAPIPPPVPAPDSVEED
VSRCSSVQFECKRDGKCIDKALECNHKYDCEDGSDETECEYFKAAMARRGESTSTSTTTTEQQHQRQHHQAQQAQQHQQQ
QERQQQERQQHERQQQERQQQDRQQQAQQHHQAQQHHSQQHPAQPAQPSQDHHEEHRRRLEEHRRREEEHHRRQEEESRA
RALQQSLLHASQVESTEVTFQDEYDGDSGVGCLEHEFQCAIGECIDKRRVCDTRPDCLDASDEQNCADRAPAPLPTHSQQ
HHHVAQPAAPPSLPSVNTYPDQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSS
AHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGE
PDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSF
HCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTI
HDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNC
DQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDAACDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLT
FDGTTDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVET
YETNYEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCED
CAPGYERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVT
QQCSASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTSYGG
TLEYTFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLADLDTLLIK
STYNDDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKE
YGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYY
GDATKGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPH
EGGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQY
GTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPSGVQEQQGILHIPRASDQEVG
QYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKDGRPLPNGIL
ERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFV
KRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPIIDPAEQTVPEGSPFKIRCYV
PGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPATVHVTNAAAPPQVEARPPQHP
VITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQDAGEYVCLYSPENSPPVKTN
PSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVNQDGDDIVISEAGDRNVGEYV
CSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPNGSPLPHDVTPLEPNILD
FSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEVEWLHDPGPE
RGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKGELICT
ATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSANADDEPKVEIEPP
RVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVYRCNVEDNNGLVIGSAFTAVS
VGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEG
FVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDLKEDNAGVYRC
VAKTKAGPLQTRTVLNVGSGKQDQVTFTVADSLPVVYTVGQPAYLSCIGKTETKPNQSVVWTKEEGDLPSGSRVEQGVLM
LPSVHRDDEGSYTCEIVKEENPVFSTVDLQIDDFIPVIDGEPIELPPLSDEEIVNLDIEITLNTANPKGIIFETKRINSG
DLLATPYDTIHHEAKITDYGTVLYEFDIGNGRQIVETTNPINPNEWNVIKIKNDKNQVTIQLNDESATIRQHTNPLPSLS
TGVNRPVFIGGRHEPTNEANDFRGIISQVVLSGHNVGLGDARIPSSVVKYDACASTNLCLNGANCRNANNHHGFSCECAE
EFHGEYCQWRSNSCHDESCNTGICLDNEESWQCVCPLGTTGLRCEEKTEIPQPLGFTSDTSFLAVKRPVKFESIKMKLRP
QADSDEHILMYFASDYGSNTKQYTSLSLIANQVVLTVRRPDKEVQKIRSETLEAGELIDVAVRQAGNALVMTVDGNQVST
IETDTLKPGTEIFIGGLPPGLNSPDDVVEQSFQGCVYEILINSQDVDLQNLSSSGDISSCEESQFPVEEDDTTTTTTTEE
PEAVIEEPTTEEPTTTEEPITEEPTEEPTTTEEPTTTEEPTTTTEEPTTTTTEEPYHIYETSRDDDPEIIIPVETTTTST
TTTSTTEEPEAEPALVLPTDPVEENDVSDEEEEISTISTVSPDNGLDSDSDYSEGTLPPDSSSEEIVVGDVYSTQEPNNI
CANSTCGMNGQCVPRNMTHYTCECKLYYDGPTCSLFKPIEHAARFDGDAFIELSSDEFPHLTSEKDEIVAFKFKTEQQNG
VLLWQGQRPTVQQMEDYISVGIVNGHLHFSYELGGGAAHLISEERVDDGKEHSVRFERKGREGQMRIDNYREVDGRSTGI
LAMLNVDGNIFVGGVPDISKATGGLFSNNFVGCIADVELNGVKLDLMATAIDGKNVKPCDEWMHRKRWLYRRRVR
Estimated Isoelectric Point:
4.82344818115234
Estimated Molecular Weight:
447.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr284
Lys153
Gln228
Leu229
Gly299
Met25
Ser289
Tyr106
His118
Glu318
Arg210
Cys178
Phe107
Pro306
Val291
Asn183
Ala245
Ile179
Trp35
Asp292