Sequence:
download
CE53458sequence.fasta
>F49E2.5, isoform m MRSPKSVRRPHIRQQLTNRRKNLGRVAKSQRNQFRQWLLTAVLPNSINDQRKEAFASLELTEQPQQVEKVKKSEKKKAQK QIAKDHEAEQKVNAKKAAEKEARRAEAEAKKRAAQEEEHKQWKAEQERIQKEQEKKEADLKKLQAEKKKEKAVKAEKAEK AEKTKKASTPAPVEEEIVVKKVANDRSAAPAPEPKTPTNTPAEPAEQVQEITGKKNKKNKKKSESEATAAPASVEQVVEQ PKVVTEEPHQQAAPQEKKNKKNKRKSESENVPAASETPVEPVVETTPPASENQKKNKKDKKKSESEKVVEEPVQAEAPKS KKPTADDNMDFLDFVTAKEEPKDEPAETPAAPVEEVVENVVENVVEKSTTPPATENKKKNKKDKKKSESEKVTEQPVESA PAPPQVEQVVETTPPASENKKKNKKDKKKSESEKAVEEPVQAAPSSKKPTADDSMDFLDFVTAKPDRSEVAAPVEVAKVD ESTAVTSENRKKNKKDKKKSESEKAVEEPVQAAPTSKKPTADDSMDFLDFVTAKEERVEEVAPVQEQVKEQKKSKKSKKT SESESKRPTADDSMDFLDFVTAKPEKPEQVVEEQPVVQEVPKPEEKASKKNKKNKRKSESEKNESPESEPVAKLITVSNT EASAVNVMGFSDIVTPKADEVITQDPVSAKQEVLPEHVPSEIPEEPVAVSKKPTADSMDFLDFVTPKTEAESTSEAPAPV VSKPTESIEDLEIVTYEHVADVTGNTLSPSQHSTPSPNSVLLNGPQSKSSKRKHHHKKNKKRTDSEMSQEPSKEDLEFLE FLHSEPKKVEKPVAPVSKKPTADDNMDFLDFVTAKPEKTESVEEHIEAPMIVEPVHAENETAAAAGGKKKNKKNKNKKNS ESESTPAAEPVKEVTPEIVEEVFEKKTITPSTAAAAAPAPGSKKNKKNKKNSESESAPAAEPVKEVTPEIVEEVFEKKTV TPSTEAAAAPASASKKNKKNKKGSGISESHDTAPAPTVEIPQTTEGGKGSPGSDKENSGSAVNGSAKKQMSVEELDYGVP GQTTDTTTDKKNKKKNKKGKNSNSISENAQVIAHLEQDHLDQMADDEVQAITGAAGSHSPPIQVHEVTSSEQHSNGVEKN TTIEITQAVDGTDMSQTQFQKNVEKLVQATLAKHDIVEIDPTVKLRIDAQLIKLSEKKAPAVVMEHVNYIKPLPMELHVS RPSTPSRDRVYKLLPKDIIFCAGLMDSHGENYAAMAADERNIFKDTSRALQRKIRIFKESPHYHTYLRAKEENRPIEEVI AEAQH
view sequence (1285 aa)
>F49E2.5, isoform m
MRSPKSVRRPHIRQQLTNRRKNLGRVAKSQRNQFRQWLLTAVLPNSINDQRKEAFASLELTEQPQQVEKVKKSEKKKAQK
QIAKDHEAEQKVNAKKAAEKEARRAEAEAKKRAAQEEEHKQWKAEQERIQKEQEKKEADLKKLQAEKKKEKAVKAEKAEK
AEKTKKASTPAPVEEEIVVKKVANDRSAAPAPEPKTPTNTPAEPAEQVQEITGKKNKKNKKKSESEATAAPASVEQVVEQ
PKVVTEEPHQQAAPQEKKNKKNKRKSESENVPAASETPVEPVVETTPPASENQKKNKKDKKKSESEKVVEEPVQAEAPKS
KKPTADDNMDFLDFVTAKEEPKDEPAETPAAPVEEVVENVVENVVEKSTTPPATENKKKNKKDKKKSESEKVTEQPVESA
PAPPQVEQVVETTPPASENKKKNKKDKKKSESEKAVEEPVQAAPSSKKPTADDSMDFLDFVTAKPDRSEVAAPVEVAKVD
ESTAVTSENRKKNKKDKKKSESEKAVEEPVQAAPTSKKPTADDSMDFLDFVTAKEERVEEVAPVQEQVKEQKKSKKSKKT
SESESKRPTADDSMDFLDFVTAKPEKPEQVVEEQPVVQEVPKPEEKASKKNKKNKRKSESEKNESPESEPVAKLITVSNT
EASAVNVMGFSDIVTPKADEVITQDPVSAKQEVLPEHVPSEIPEEPVAVSKKPTADSMDFLDFVTPKTEAESTSEAPAPV
VSKPTESIEDLEIVTYEHVADVTGNTLSPSQHSTPSPNSVLLNGPQSKSSKRKHHHKKNKKRTDSEMSQEPSKEDLEFLE
FLHSEPKKVEKPVAPVSKKPTADDNMDFLDFVTAKPEKTESVEEHIEAPMIVEPVHAENETAAAAGGKKKNKKNKNKKNS
ESESTPAAEPVKEVTPEIVEEVFEKKTITPSTAAAAAPAPGSKKNKKNKKNSESESAPAAEPVKEVTPEIVEEVFEKKTV
TPSTEAAAAPASASKKNKKNKKGSGISESHDTAPAPTVEIPQTTEGGKGSPGSDKENSGSAVNGSAKKQMSVEELDYGVP
GQTTDTTTDKKNKKKNKKGKNSNSISENAQVIAHLEQDHLDQMADDEVQAITGAAGSHSPPIQVHEVTSSEQHSNGVEKN
TTIEITQAVDGTDMSQTQFQKNVEKLVQATLAKHDIVEIDPTVKLRIDAQLIKLSEKKAPAVVMEHVNYIKPLPMELHVS
RPSTPSRDRVYKLLPKDIIFCAGLMDSHGENYAAMAADERNIFKDTSRALQRKIRIFKESPHYHTYLRAKEENRPIEEVI
AEAQH
Estimated Isoelectric Point:
6.77574920654297
Estimated Molecular Weight:
141.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr81
Lys193
Gln60
Leu39
Gly25
Met17
Ser107
Tyr7
His26
Glu170
Arg33
Cys1
Phe23
Pro103
Val112
Asn58
Ala131
Ile37
Trp2
Asp60