Sequence:
download
CE53404sequence.fasta
>LGC-58, isoform m MLLVSSIFLLLYRNSPKVEASRSEPVPIYLDNLLNAGRQVYDNQSPPVQHDKEEVTVVELAMYIEGMSSFRTQTMDFQLD VYFQQFWRDPRLAHNETRRVLVKDKAVLHKMWKPDVYFANARIAEFHEVTQPNFLVWIQPDGSILYDTRISMVVVCTLNL EKWPLDSQRCHLRILSYAYTTEQLVIKWKEDEPITRNPNIAMSDMHIVDLYPGLCDGNYSTGTWSCVTAEFFVKREITHH VMQSYVPTTLIVVISWFSFWLDVEAVPARVSLAITTLLTLSTQANAARMALPEVSYMKAIDVWMGACMMFVFGVMIEFTI VNYAQRQVMASSLESVKSGNAEKKPSRGDLGAHARHLFLRLRTNERQHLVEAAPVVQPPQNEDAEAQEEVWAEQKETNLS EVWKESDPAERLAHWNEKENDASSPLMGNGRAHVRYGAAEKMKNRKCNDSSRKKEKWSSAIKQIQKHKKIAGRNRAKKID QTSRWIFPLTFIIFNLTYWIYYLYWKE
view sequence (507 aa)
>LGC-58, isoform m
MLLVSSIFLLLYRNSPKVEASRSEPVPIYLDNLLNAGRQVYDNQSPPVQHDKEEVTVVELAMYIEGMSSFRTQTMDFQLD
VYFQQFWRDPRLAHNETRRVLVKDKAVLHKMWKPDVYFANARIAEFHEVTQPNFLVWIQPDGSILYDTRISMVVVCTLNL
EKWPLDSQRCHLRILSYAYTTEQLVIKWKEDEPITRNPNIAMSDMHIVDLYPGLCDGNYSTGTWSCVTAEFFVKREITHH
VMQSYVPTTLIVVISWFSFWLDVEAVPARVSLAITTLLTLSTQANAARMALPEVSYMKAIDVWMGACMMFVFGVMIEFTI
VNYAQRQVMASSLESVKSGNAEKKPSRGDLGAHARHLFLRLRTNERQHLVEAAPVVQPPQNEDAEAQEEVWAEQKETNLS
EVWKESDPAERLAHWNEKENDASSPLMGNGRAHVRYGAAEKMKNRKCNDSSRKKEKWSSAIKQIQKHKKIAGRNRAKKID
QTSRWIFPLTFIIFNLTYWIYYLYWKE
Estimated Isoelectric Point:
7.66345977783203
Estimated Molecular Weight:
58.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr26
Lys30
Gln23
Leu42
Gly15
Met18
Ser35
Tyr19
His14
Glu36
Arg30
Cys6
Phe19
Pro23
Val42
Asn24
Ala39
Ile27
Trp16
Asp23