Sequence:
download
CE53300sequence.fasta
>RGS-7, isoform j MSDEDADEYDDQSSISSVSDDDDFSGSESESYQDTTESTGPSEATTDEMLWGRRRAPVCGIAAQAVRRQILMNQQHEPNV LGNNKKVYQTFGSTPQLANERHKEMYSQIRRGDDSSFRSRDRFVPPRRPRMGYGSSDLSAIEEMSPIRSSTYSSSSEAHR LSSLRAQTEWKPQLTSTTTSFQPLSPMNHHDKENGPFKAPMSPVCSSTPRSQRMYRKNPKYRRQFGSSLQLSESRLEEST SQESERAVTPESWMEHNNENEHPDQMMFAKPKQGSFPRPEAFGLDNAYAKHKDIRGIIFLSMSLCGRRLTLNVQNAAYFC SAARPTSVCSYVSAVLCHRPSSQSSSSSRQYRQRPDECYRTRLVTNCNSPSFDESFYFTFSENCVRDLLIVTVYEMDSNN AEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDPMEDVEINNEGFFLLNKDQGRKQNFPQRKMLQVRRQTFYEDPAF TGVSSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRAT LPSITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGRE EDKEKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEE FKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFL DLLESYEITDKEDKPSSSKDKN
view sequence (822 aa)
>RGS-7, isoform j
MSDEDADEYDDQSSISSVSDDDDFSGSESESYQDTTESTGPSEATTDEMLWGRRRAPVCGIAAQAVRRQILMNQQHEPNV
LGNNKKVYQTFGSTPQLANERHKEMYSQIRRGDDSSFRSRDRFVPPRRPRMGYGSSDLSAIEEMSPIRSSTYSSSSEAHR
LSSLRAQTEWKPQLTSTTTSFQPLSPMNHHDKENGPFKAPMSPVCSSTPRSQRMYRKNPKYRRQFGSSLQLSESRLEEST
SQESERAVTPESWMEHNNENEHPDQMMFAKPKQGSFPRPEAFGLDNAYAKHKDIRGIIFLSMSLCGRRLTLNVQNAAYFC
SAARPTSVCSYVSAVLCHRPSSQSSSSSRQYRQRPDECYRTRLVTNCNSPSFDESFYFTFSENCVRDLLIVTVYEMDSNN
AEKKRILGCMTFPVSRILKKASQVVGDPFPHYRRQDPMEDVEINNEGFFLLNKDQGRKQNFPQRKMLQVRRQTFYEDPAF
TGVSSAGSSVISNNTGGQMTMASPRLSVPNELTMGDYYRSTGSSDMRGRSTNNLLDYTSASSSTNGSAGGPEKLKLHRAT
LPSITTTTSENNSDDAKSLSPEQSPTDHHFLCPDDNGGVYGAGPAHSAIKKSSVRRAASFTFSPKHSSSKTNLRQLNGRE
EDKEKKRFLGPISRTLSYLRSKMDLALSTSSLYPSRDDVRQWEISFESLLNNKFGCALFRQFLKKEFSDENMDFWLECEE
FKKMKDGKKSTTQKAIEIYSEFVAEHSPKEVNLDSDTRAATKAAVEAGCKPDTFALAQSRVEQLMSKDSYRRFLRDRLFL
DLLESYEITDKEDKPSSSKDKN
Estimated Isoelectric Point:
8.05129241943359
Estimated Molecular Weight:
92.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr48
Lys47
Gln37
Leu56
Gly38
Met25
Ser116
Tyr26
His16
Glu57
Arg65
Cys14
Phe38
Pro45
Val31
Asn39
Ala46
Ile21
Trp5
Asp52