Sequence:
download
CE53027sequence.fasta
>SIPA-1, isoform m MSSTTSSVRSANRTRSLCHHLHHQPLLVSGSSTGSPPIGGSMDEGSSASTSSSATARALDMFNRRGNTAADVLPPSAGVP NTSAVSSSSGVISADQPSSTNSDNDTETFNEWRPPFPRLSAYQDCLSLAAAWGLGMHPNGLDDKPTGASQAQSPSEDDSG DGKFNELLASCPAFRNELGWEPTRRFALSRHTFDMAHTDAHECETWMREHSASEAGILEDVSNVYLGGRLCAARQPKTVI EPQDIGSYYYRHCFISKNHIEYLGMDDILGPISISMVREIVDRKESYSIYRMIVRISDQKTIRVAVPEEALSTPEGSDRA TRPLMRELLEIVCPKISFGILRPSIQSPRVEELIMKIDEQPIYTRYKVGIMLCKNEQSTEEQMYNNEFSTPSFDEFLDFL GQRVTLKGFEAYKGGLDTRGDTTGTHSIYSEYQAHEIMFHVSTLLPFTPSNRQQLSRKRHIGNDMVTIVFQEPGALPFSP ITVRSHFQHVFIIVRVHNECSENVTYSVAVSRSKDVPAFGPPVPKGACFSKCAEFHDWLLTKIINAENAVHRSKKFATMA ARTRREALRDLVENYVGPHQNEGASKIASRFLGGSVKRKERHNPKPTNHVMRGALSWLVDVHDYSTNQRISCVLGVAQDW IVLLERPSGTVLFSTPTHSIIGWATSDTGLKLYYDHGDQLLLRCYSETCTDSELNELIRRLENVTKGDEAKEVVLRRLKT TDNWGFHVQDEGVVTDVEMYQLAWKAGIRQGSRIVEMDSMPISTLSFDKICDQLAVSECVRLLMISPSSDGSPRRGCEDP NCPAVKGIEQMLTPDAFAKQPITYHEMFRQKKLEYPTNSASSSPASSFDERTFSFTATKKTIEQRANNIFRSNNRPNTLS SASVHDNMCTLLNPPKYLNRAQSDEQLRSPLMDELNRKAPLSARESTNERESSELVRIQTHLERTVQEKRALEMLAQQLK KQLIQERQSHDNTKREMERLKKMYEKK
view sequence (987 aa)
>SIPA-1, isoform m
MSSTTSSVRSANRTRSLCHHLHHQPLLVSGSSTGSPPIGGSMDEGSSASTSSSATARALDMFNRRGNTAADVLPPSAGVP
NTSAVSSSSGVISADQPSSTNSDNDTETFNEWRPPFPRLSAYQDCLSLAAAWGLGMHPNGLDDKPTGASQAQSPSEDDSG
DGKFNELLASCPAFRNELGWEPTRRFALSRHTFDMAHTDAHECETWMREHSASEAGILEDVSNVYLGGRLCAARQPKTVI
EPQDIGSYYYRHCFISKNHIEYLGMDDILGPISISMVREIVDRKESYSIYRMIVRISDQKTIRVAVPEEALSTPEGSDRA
TRPLMRELLEIVCPKISFGILRPSIQSPRVEELIMKIDEQPIYTRYKVGIMLCKNEQSTEEQMYNNEFSTPSFDEFLDFL
GQRVTLKGFEAYKGGLDTRGDTTGTHSIYSEYQAHEIMFHVSTLLPFTPSNRQQLSRKRHIGNDMVTIVFQEPGALPFSP
ITVRSHFQHVFIIVRVHNECSENVTYSVAVSRSKDVPAFGPPVPKGACFSKCAEFHDWLLTKIINAENAVHRSKKFATMA
ARTRREALRDLVENYVGPHQNEGASKIASRFLGGSVKRKERHNPKPTNHVMRGALSWLVDVHDYSTNQRISCVLGVAQDW
IVLLERPSGTVLFSTPTHSIIGWATSDTGLKLYYDHGDQLLLRCYSETCTDSELNELIRRLENVTKGDEAKEVVLRRLKT
TDNWGFHVQDEGVVTDVEMYQLAWKAGIRQGSRIVEMDSMPISTLSFDKICDQLAVSECVRLLMISPSSDGSPRRGCEDP
NCPAVKGIEQMLTPDAFAKQPITYHEMFRQKKLEYPTNSASSSPASSFDERTFSFTATKKTIEQRANNIFRSNNRPNTLS
SASVHDNMCTLLNPPKYLNRAQSDEQLRSPLMDELNRKAPLSARESTNERESSELVRIQTHLERTVQEKRALEMLAQQLK
KQLIQERQSHDNTKREMERLKKMYEKK
Estimated Isoelectric Point:
6.61948394775391
Estimated Molecular Weight:
110.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr63
Lys45
Gln39
Leu78
Gly52
Met28
Ser105
Tyr25
His31
Glu71
Arg72
Cys19
Phe34
Pro54
Val55
Asn42
Ala63
Ile49
Trp10
Asp52