Sequence:
download
CE52909sequence.fasta
>T25B9.1 MRRCFSTATNYFEIHLKNELAGIKNAGTFKTERVIQGRQGVLVKVTGSDKPVINFCANNYLGLSSHPEVIAAGQKALETH GAGLSSVRFICGTQDIHKELEQKIAQFHGTEDTILYAACFDANGGIFEVMTGEQDSIISDELNHASIIDGIRLSKAKRLR YKHLDLGDLESKLKEAEDSRFRLIVTDGVFSMDGDVAPLGDITSLAEKYNALLFIDECHATGFFGKTGRGTAEAVGGRPD VINSTLGKALGGSMGGYTTGPKPLIDLLRQRSRPYLFSNSLAPSIVGSSIKVFDLLMNDSSFIGSLQTNVSHFRKSMAAN GFTILGNDPTHPICPVLLGDAKLAATMADELLKMGIYVIGFSFPVVPKGKARIRVQISAAHSKQHIDQLIEAFATVGKKL NVI
view sequence (403 aa)
>T25B9.1
MRRCFSTATNYFEIHLKNELAGIKNAGTFKTERVIQGRQGVLVKVTGSDKPVINFCANNYLGLSSHPEVIAAGQKALETH
GAGLSSVRFICGTQDIHKELEQKIAQFHGTEDTILYAACFDANGGIFEVMTGEQDSIISDELNHASIIDGIRLSKAKRLR
YKHLDLGDLESKLKEAEDSRFRLIVTDGVFSMDGDVAPLGDITSLAEKYNALLFIDECHATGFFGKTGRGTAEAVGGRPD
VINSTLGKALGGSMGGYTTGPKPLIDLLRQRSRPYLFSNSLAPSIVGSSIKVFDLLMNDSSFIGSLQTNVSHFRKSMAAN
GFTILGNDPTHPICPVLLGDAKLAATMADELLKMGIYVIGFSFPVVPKGKARIRVQISAAHSKQHIDQLIEAFATVGKKL
NVI
Estimated Isoelectric Point:
8.12691497802734
Estimated Molecular Weight:
43.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr23
Lys26
Gln12
Leu39
Gly40
Met8
Ser30
Tyr8
His12
Glu19
Arg18
Cys6
Phe21
Pro13
Val23
Asn16
Ala34
Ile32
Asp23