Sequence:
download
CE52692sequence.fasta
>UNC-2, isoform p MNPLHRSSYRPTKTKYYLPLSRTPSHRKPKTSATSTYSAEKSGDESVTINIEFSYRSQSSGTSTLQKNRKPSEPPKSKRS SRDDNSNGYAGYEDATPRPSIDFPTAVIEAARRASVLGRSAAESLSAQEAASSSERGEHTNSRSPSTSYSSCIDDERKFS SPHRRRVVDVSDHKTCALLMTRMKEASRQLPSPSQLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNI IRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLR SGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVL FAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMI TVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIEREL NGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEGGTVEDEFAER KKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFA MGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLL FLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLF GNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECE EEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTG VFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLK AVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFN YDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAEL SEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFN TALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILL WTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKD CARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATG RIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLT LKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSH TPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKM NSTGRRLSDMFSKIRRGTSADHNPHQTEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSI RDPIIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFR RYQDSTPQDVSEDDDPMPTAVRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYHTSHSHSHHPTSQQQQH QPMYSTSPLISPRSSHSYYTPRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDS ETEDDPRWAIV
view sequence (2171 aa)
>UNC-2, isoform p
MNPLHRSSYRPTKTKYYLPLSRTPSHRKPKTSATSTYSAEKSGDESVTINIEFSYRSQSSGTSTLQKNRKPSEPPKSKRS
SRDDNSNGYAGYEDATPRPSIDFPTAVIEAARRASVLGRSAAESLSAQEAASSSERGEHTNSRSPSTSYSSCIDDERKFS
SPHRRRVVDVSDHKTCALLMTRMKEASRQLPSPSQLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNI
IRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLR
SGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVL
FAIIIFAIIGLEFYSGAFHSACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMI
TVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIEREL
NGYLEWILTAEEVILKEDRTTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEGGTVEDEFAER
KKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFA
MGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLL
FLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLF
GNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECE
EEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTG
VFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLK
AVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFN
YDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAEL
SEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFN
TALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILL
WTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKD
CARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATG
RIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLT
LKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSH
TPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKM
NSTGRRLSDMFSKIRRGTSADHNPHQTEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSI
RDPIIRRNRYNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFR
RYQDSTPQDVSEDDDPMPTAVRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYHTSHSHSHHPTSQQQQH
QPMYSTSPLISPRSSHSYYTPRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDS
ETEDDPRWAIV
Estimated Isoelectric Point:
6.50946807861328
Estimated Molecular Weight:
247.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr123
Lys87
Gln98
Leu182
Gly118
Met67
Ser187
Tyr89
His52
Glu143
Arg136
Cys37
Phe135
Pro112
Val133
Asn88
Ala139
Ile128
Trp24
Asp93