Sequence:
download
CE52381sequence.fasta
>CEH-22, isoform e MQLASETRVFPVSGYSATPTFSFDPCTYGSYDPSAYFASNGIAGSMYTLPDQFPRSENDMLDNSNTSNGNKSDKDGIKLE DEDEILEDEENDEEDDGTGKRKKRKRRVLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKK SHTDKPINAALLTTMPNAFSSQSTAASFPTRAMPIPMLVRDSSARSSDISSTSPYTVAFGSANSGYLPTPSAYLPATSGY FSNGPSAASSYMTNTQWWPS
view sequence (260 aa)
>CEH-22, isoform e
MQLASETRVFPVSGYSATPTFSFDPCTYGSYDPSAYFASNGIAGSMYTLPDQFPRSENDMLDNSNTSNGNKSDKDGIKLE
DEDEILEDEENDEEDDGTGKRKKRKRRVLFTKAQTYELERRFRSQKYLSAPEREALAMQIRLTPTQVKIWFQNHRYKTKK
SHTDKPINAALLTTMPNAFSSQSTAASFPTRAMPIPMLVRDSSARSSDISSTSPYTVAFGSANSGYLPTPSAYLPATSGY
FSNGPSAASSYMTNTQWWPS
Estimated Isoelectric Point:
6.18572235107422
Estimated Molecular Weight:
29.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr23
Lys14
Gln9
Leu15
Gly12
Met8
Ser35
Tyr13
His2
Glu14
Arg15
Cys1
Phe12
Pro19
Val6
Asn13
Ala22
Ile8
Trp3
Asp16