Sequence:
download
CE52350sequence.fasta
>PAR-1, isoform m MPDEEETSRLAWTKRLSRRLNKRSSSLIASLLGSRNGATSSKTINEPTTTEDELDEESMEEMKRRELIAARRASAAPNVE NRVGNRHGGKEKSTSRRRSVDRIYAYKVKEHVNTPPGDNQQKSSKENQKSNKDKQSSNQPPGQIPHSTNSGTRKSSGSGL KTANLKHPARPSTESSTSSSHHRRPAQEMNGTSTATATGGGGTSGATTTASSGAPAASSGGSSARYSSSGRSHPTSGSSS SHARSTGQSGMSSRSAARRNDQDVHVGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIM KQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLD QDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLR GKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLIQIFQLGFNKAA ILESVEKEKFEDIHATYLLLGERKSDMDASEITMAQSLLSHSSINVSSSLGQHPAGVITREHVTSSSASGSSASPSRYSR SSATATGASITAGSALASAANAQKHQQSSAAPSSGSSSSRRSSQNDAAATAAGGTVVMSGTRHGGVQMRAQPTSRQATIS LLQPPSYKPSSNTTQIAQIPPLFNRNSTATSSAAQPSTGITGTRKIADPKGRIPLNSTAVQGHRTATGAVAANNGGIPSH RDHAQQQQYMNQLTSSTMMSKLINKTPAAGGTAATSSSSSSSATSTAPLQKSGSQISHAPTEPVIREDDDENNSENQNGN VPLIGGVGPQTSPAVQVPTEDATSSSDKEQQQQKASSETPKESNPIVWQNLHLNSLLKSLLDSSAATSYETPRRPGIAGR RSEPSAATPRRRHQTMVVDARHLQTPPDTDRPYHFEDTTLDRQMRALYVSTASSRMTRGVLPTPPTSNSTSSSFIVEPLT HVAAASPDITTTTPTKSTVTTSPYFRRTPSFRMAVDDPPISINASITDDDCDGIIEIEREWSNGGTDSGDGRSTTTSHIT ANVSFGNNQ
view sequence (1129 aa)
>PAR-1, isoform m
MPDEEETSRLAWTKRLSRRLNKRSSSLIASLLGSRNGATSSKTINEPTTTEDELDEESMEEMKRRELIAARRASAAPNVE
NRVGNRHGGKEKSTSRRRSVDRIYAYKVKEHVNTPPGDNQQKSSKENQKSNKDKQSSNQPPGQIPHSTNSGTRKSSGSGL
KTANLKHPARPSTESSTSSSHHRRPAQEMNGTSTATATGGGGTSGATTTASSGAPAASSGGSSARYSSSGRSHPTSGSSS
SHARSTGQSGMSSRSAARRNDQDVHVGKYKLLKTIGKGNFAKVKLAKHVITGHEVAIKIIDKTALNPSSLQKLFREVKIM
KQLDHPNIVKLYQVMETEQTLYLVLEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYLHSKNIIHRDLKAENLLLD
QDMNIKIADFGFSNTFSLGNKLDTFCGSPPYAAPELFSGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLR
GKYRIPFYMSTDCENLLKKFLVINPQRRSSLDNIMKDRWMNVGYEDDELKPFIEPPKDQIDEQRIEKLIQIFQLGFNKAA
ILESVEKEKFEDIHATYLLLGERKSDMDASEITMAQSLLSHSSINVSSSLGQHPAGVITREHVTSSSASGSSASPSRYSR
SSATATGASITAGSALASAANAQKHQQSSAAPSSGSSSSRRSSQNDAAATAAGGTVVMSGTRHGGVQMRAQPTSRQATIS
LLQPPSYKPSSNTTQIAQIPPLFNRNSTATSSAAQPSTGITGTRKIADPKGRIPLNSTAVQGHRTATGAVAANNGGIPSH
RDHAQQQQYMNQLTSSTMMSKLINKTPAAGGTAATSSSSSSSATSTAPLQKSGSQISHAPTEPVIREDDDENNSENQNGN
VPLIGGVGPQTSPAVQVPTEDATSSSDKEQQQQKASSETPKESNPIVWQNLHLNSLLKSLLDSSAATSYETPRRPGIAGR
RSEPSAATPRRRHQTMVVDARHLQTPPDTDRPYHFEDTTLDRQMRALYVSTASSRMTRGVLPTPPTSNSTSSSFIVEPLT
HVAAASPDITTTTPTKSTVTTSPYFRRTPSFRMAVDDPPISINASITDDDCDGIIEIEREWSNGGTDSGDGRSTTTSHIT
ANVSFGNNQ
Estimated Isoelectric Point:
9.50232696533203
Estimated Molecular Weight:
121.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr96
Lys62
Gln55
Leu71
Gly76
Met23
Ser161
Tyr23
His31
Glu58
Arg72
Cys3
Phe22
Pro65
Val49
Asn54
Ala97
Ile54
Trp5
Asp52