Sequence:
download
CE52322sequence.fasta
>UNC-68, isoform k MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSM RALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQR SEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPE NWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTAFV MCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMA LEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQ DLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSN PQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLL QTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSY GFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQ GRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHE LWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQ NGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAA ENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGA DDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSG QRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKILQK VTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLG SKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKNFR DSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKMER EKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSEAD HHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPT ATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIM SVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIG LHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFEAL KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLTQL ELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLL MCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPPPV LEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYL IQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKDAS EMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAI ALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAI LRSLISLDDLGQILALRFTIPNLAAPSIEAVRRANAVQASHTQKAVMAHTFAMVASLASEVSNTRRSQTFTSGTNLAKRG LPCVEEVDTDDSKSSDYASVHTSFSSGNELFAPKAEKEKVDVLKLNENKYPIIQRRRSSRFNPIDNTGPLPGLLPNHKGS VLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDA TLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSR CEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFE MMDRDANDRASAARTLSGTSISNFAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLL TDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQNDRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQEL TRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKIT VKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTM FAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSN KFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKED QRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEE EHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYV AQFEEDAAATGGGDMKTGKAAIAERKKKRREGQIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETE EKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTMTSRMEKEDIWKKVL TLQRKRMAISLITASHLYKTELHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSED TKEKETNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQ AVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMF ERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMD FYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLEL LREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKE FQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLE YFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAI SSGDSDTKMERAIKQRDYFLQQTSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQMSWTQLLYAVIILFIR AGLAIGWAGYLLLMTIFRFGYFLTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNS LPDFVPPERPETPETVLEEEKPLNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKSRG SILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQIL YWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDK FVRRKTRSKFKDQVDEETLTSILGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLID VVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAG GGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRG FEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
view sequence (5185 aa)
>UNC-68, isoform k
MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSM
RALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQR
SEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPE
NWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTAFV
MCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMA
LEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQ
DLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSN
PQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLL
QTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSY
GFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQ
GRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHE
LWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQ
NGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAA
ENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGA
DDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSG
QRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKILQK
VTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLG
SKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKNFR
DSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKMER
EKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSEAD
HHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPT
ATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIM
SVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIG
LHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFEAL
KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLTQL
ELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLL
MCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPPPV
LEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYL
IQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKDAS
EMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS
RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAI
ALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAI
LRSLISLDDLGQILALRFTIPNLAAPSIEAVRRANAVQASHTQKAVMAHTFAMVASLASEVSNTRRSQTFTSGTNLAKRG
LPCVEEVDTDDSKSSDYASVHTSFSSGNELFAPKAEKEKVDVLKLNENKYPIIQRRRSSRFNPIDNTGPLPGLLPNHKGS
VLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDA
TLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH
YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSR
CEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFE
MMDRDANDRASAARTLSGTSISNFAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLL
TDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQNDRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQEL
TRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKIT
VKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTM
FAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSN
KFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKED
QRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEE
EHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYV
AQFEEDAAATGGGDMKTGKAAIAERKKKRREGQIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETE
EKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTMTSRMEKEDIWKKVL
TLQRKRMAISLITASHLYKTELHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSED
TKEKETNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQ
AVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMF
ERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMD
FYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLEL
LREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKE
FQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLE
YFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAI
SSGDSDTKMERAIKQRDYFLQQTSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQMSWTQLLYAVIILFIR
AGLAIGWAGYLLLMTIFRFGYFLTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNS
LPDFVPPERPETPETVLEEEKPLNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKSRG
SILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQIL
YWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDK
FVRRKTRSKFKDQVDEETLTSILGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLID
VVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAG
GGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRG
FEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Estimated Isoelectric Point:
5.52626800537109
Estimated Molecular Weight:
589.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr257
Lys314
Gln233
Leu532
Gly302
Met179
Ser376
Tyr156
His134
Glu415
Arg264
Cys90
Phe252
Pro194
Val291
Asn217
Ala332
Ile282
Trp61
Asp304