Sequence:
download
CE52247sequence.fasta
>UNC-68, isoform j MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSM RALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQR SEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPE NWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTAFV MCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMA LEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQ DLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSN PQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLL QTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSY GFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQ GRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHE LWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQ NGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAA ENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGA DDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSG QRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKILQK VTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLG SKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKNFR DSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKMER EKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSEAD HHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPT ATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIM SVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIG LHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFEAL KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLTQL ELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLL MCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPPPV LEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYL IQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKDAS EMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAI ALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAI LRSLISLDDLGQILALRFTIPNLAAPSIEDTGPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMD SPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPA MMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNHYGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKA LPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDL YSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISNFAPKPIDLSSMTL EKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQN DRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFL EGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCA DDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLS SSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDL ETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENA PWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEEHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKY TDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKKKRREGQDKM KEYFDRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPTDK NAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTMTSRMEKEDIWKKVLTLQRKRMAISLITASHLYKTEL HRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEDTKEKETNPDPLKQLIRCFQRAA TSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQAVLASRGAAIMCLMYLSASGGE PNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQN LNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRA IQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGN VLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMC TDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIY FEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAISSGDSDTKMERAIKQRDYFLQQ TSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQMSWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFGYF LTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNSLPDFVPPERPETPETVLEEEKP LNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKSRGSILNMLARNFKTIEKITLYLAF FINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLK IPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSI LGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQL ILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFY DISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLV NKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
view sequence (5083 aa)
>UNC-68, isoform j
MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSM
RALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQR
SEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPE
NWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTAFV
MCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMA
LEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQ
DLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSN
PQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLL
QTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSY
GFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQ
GRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHE
LWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQ
NGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAA
ENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGA
DDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSG
QRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKILQK
VTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLG
SKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKNFR
DSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKMER
EKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSEAD
HHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPT
ATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIM
SVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIG
LHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFEAL
KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLTQL
ELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLL
MCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPPPV
LEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYL
IQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKDAS
EMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS
RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAI
ALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAI
LRSLISLDDLGQILALRFTIPNLAAPSIEDTGPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMD
SPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPA
MMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNHYGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKA
LPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDL
YSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISNFAPKPIDLSSMTL
EKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQN
DRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFL
EGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCA
DDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLS
SSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDL
ETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENA
PWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEEHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKY
TDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKKKRREGQDKM
KEYFDRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPTDK
NAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTMTSRMEKEDIWKKVLTLQRKRMAISLITASHLYKTEL
HRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEDTKEKETNPDPLKQLIRCFQRAA
TSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQAVLASRGAAIMCLMYLSASGGE
PNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQN
LNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRA
IQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGN
VLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMC
TDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIY
FEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAISSGDSDTKMERAIKQRDYFLQQ
TSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQMSWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFGYF
LTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNSLPDFVPPERPETPETVLEEEKP
LNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKSRGSILNMLARNFKTIEKITLYLAF
FINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLK
IPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSI
LGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQL
ILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFY
DISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLV
NKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Estimated Isoelectric Point:
5.48108673095703
Estimated Molecular Weight:
578.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr249
Lys308
Gln229
Leu526
Gly300
Met178
Ser361
Tyr155
His131
Glu409
Arg257
Cys89
Phe248
Pro191
Val281
Asn210
Ala319
Ile280
Trp61
Asp301