Sequence:
download
CE52191sequence.fasta
>UNC-68, isoform m MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSM RALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQR SEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPE NWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTAFV MCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMA LEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQ DLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSN PQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLL QTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSY GFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQ GRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHE LWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQ NGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAA ENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGA DDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSG QRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKILQK VTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLG SKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKNFR DSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKMER EKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSEAD HHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPT ATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIM SVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIG LHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFEAL KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLTQL ELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLL MCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPPPV LEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYL IQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKDAS EMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAI ALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAI LRSLISLDDLGQILALRFTIPNLAAPSIEAVRRANAVQASHTQKAVMAHTFAMVASLASEVSNTRRSQTFTSGTNLAKRG LPCVEEVDTDDSKSSDYASVHTSFSSGNELFAPKAEKEKVDVLKLNENKYPIIQRRRSSRFNPIDNTGPLPGLLPNHKGS VLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDA TLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSR CEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFE MMDRDANDRASAARTLSGTSISNFAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLL TDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQNDRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQEL TRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKIT VKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTM FAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSN KFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKED QRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEE EHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYV AQFEEDAAATGGGDMKTGKAAIAERKKKRREGQDKMKEYFDRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDI VQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTT EHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIE IIMEEGVPIVASSEDTKEKETNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEID QAAKEEQSQALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSM AGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLIN CTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFA HMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAF QDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITND PRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFIN FCEDTIFEMQHAAAISSGDSDTKMERAIKQRDYFLQQTSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQM SWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFGYFLTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVT AFGVGMNADHLNVNSLPDFVPPERPETPETVLEEEKPLNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQ YEPKIAESNSTKSRGSILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFP YVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDR IVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSAC GVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNM LTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCF ICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
view sequence (5200 aa)
>UNC-68, isoform m
MDFDFTDISDEDHNYVTKGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNALSM
RALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASKQR
SEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTIPE
NWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTAFV
MCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFFMA
LEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRSRQ
DLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRLSN
PQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDLLL
QTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFYSY
GFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGGNQ
GRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENLHE
LWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQQQ
NGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRESAA
ENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQLGA
DDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLGSG
QRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKILQK
VTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSMLG
SKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKNFR
DSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKMER
EKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSEAD
HHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVTPT
ATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVRIM
SVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLLIG
LHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFEAL
KKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLTQL
ELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFRLL
MCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPPPV
LEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLVYL
IQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKDAS
EMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVYLS
RCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKEAI
ALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRARAI
LRSLISLDDLGQILALRFTIPNLAAPSIEAVRRANAVQASHTQKAVMAHTFAMVASLASEVSNTRRSQTFTSGTNLAKRG
LPCVEEVDTDDSKSSDYASVHTSFSSGNELFAPKAEKEKVDVLKLNENKYPIIQRRRSSRFNPIDNTGPLPGLLPNHKGS
VLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATMMDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDA
TLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELPPAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNH
YGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFGKALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSR
CEINRDLEKMTELFAEHFHDSWASRKLEKGWVHGDLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFE
MMDRDANDRASAARTLSGTSISNFAPKPIDLSSMTLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLL
TDFERRKDRFRASEILKFLQYHGYHVNCPKDEQSQNDRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQEL
TRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNYFLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKIT
VKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNNCADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTM
FAHLARNHFGTDLLLDDIQAACYKILDSLYMVTGLSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSN
KFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLTDLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKED
QRASVVQTTSVSCDHINRIFNALLKMIRNHVGIENAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEE
EHMRTHPDDADEGTVAEDNARLVRDTYAFFPILMKYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYV
AQFEEDAAATGGGDMKTGKAAIAERKKKRREGQDKMKEYFDRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDI
VQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPTDKNAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTT
EHPQMQLSQAWKKVVSTQRKRAVVACFRMVPLYGIPRHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIE
IIMEEGVPIVASSEDTKEKETNPDPLKQLIRCFQRAATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEID
QAAKEEQSQALRGEQAVLASRGAAIMCLMYLSASGGEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSM
AGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDNQNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLIN
CTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFLRAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFA
HMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLEGNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAF
QDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLMMCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITND
PRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEKIYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFIN
FCEDTIFEMQHAAAISSGDSDTKMERAIKQRDYFLQQTSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQM
SWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFGYFLTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVT
AFGVGMNADHLNVNSLPDFVPPERPETPETVLEEEKPLNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQ
YEPKIAESNSTKSRGSILNMLARNFKTIEKITLYLAFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFP
YVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQLKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDR
IVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLTSILGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSAC
GVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQQLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNM
LTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRMFYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCF
ICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQHLVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Estimated Isoelectric Point:
5.54624176025391
Estimated Molecular Weight:
590.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr255
Lys314
Gln236
Leu529
Gly304
Met179
Ser375
Tyr157
His134
Glu414
Arg267
Cys91
Phe254
Pro198
Val295
Asn218
Ala333
Ile281
Trp61
Asp305