Sequence:
download
CE52133sequence.fasta
>UNC-68, isoform b MADKEEQGGGEQDDVSFLRTGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNAL SMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASK QRSEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTI PENWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTA FVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFF MALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRS RQDLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRL SNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDL LLQTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFY SYGFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGG NQGRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENL HELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQ QQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRES AAENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQL GADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLG SGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKIL QKVTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSM LGSKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKN FRDSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKM EREKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSE ADHHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVT PTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVR IMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLL IGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFE ALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLT QLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFR LLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPP PVLEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLV YLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKD ASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVY LSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKE AIALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRAR AILRSLISLDDLGQILALRFTIPNLAAPSIEDTGPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATM MDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELP PAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNHYGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFG KALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHG DLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISNFAPKPIDLSSM TLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQS QNDRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNY FLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNN CADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTG LSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLT DLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIE NAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEEHMRTHPDDADEGTVAEDNARLVRDTYAFFPILM KYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKKKRREGQD KMKEYFDRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPT DKNAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTMTSRMEKEDIWKKVLTLQRKRMAISLITASHLYKT ELHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEDTKEKETNPDPLKQLIRCFQR AATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQAVLASRGAAIMCLMYLSASG GEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDN QNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFL RAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLE GNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLM MCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEK IYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAISSGDSDTKMERAIKQRDYFL QQTSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQMSWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFG YFLTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNSLPDFVPPERPETPETVLEEE KPLNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKSRGSILNMLARNFKTIEKITLYL AFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQ LKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLT SILGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQ QLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRM FYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQH LVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
view sequence (5085 aa)
>UNC-68, isoform b
MADKEEQGGGEQDDVSFLRTGDIVCLSCVASHNRDGVLGSERVCLCTEGFGNRMCTLENVSDKDIPPDIAMCMLYIDNAL
SMRALQEMMSADSDHKSASGAGGHKTLLYGHAVQLKHVQSEMYLACLSSCSSNDKLAFDVGVQETNEGEACWWTIHPASK
QRSEGEKVRVGDDVILVSVATERYLHMAYSKGYMVIASFHQTLWNIQSVSSGSMRTRNMGFLFGNDVLRLFHGNDECLTI
PENWSEHPQHNMVIYEGGAAVTQARSLWRVELIRMKWHGALVGWEQVFRIKHITSGRYLGVLDNSVQLYHKEKADFDLTA
FVMCQNKDPKKQMLDEKEEEGMGNATIRYGETNAFIQHVKTQLWLSYQTTEVTKKGLGKVEEKKAVALKDGHMDDCYTFF
MALEEESKSARVIRKCSSVLNKFLKGIDALQLEGNQSTDWTRVDLNEVLKLMEDLIEYFAQPNDEQDFEEKQNHLRALRS
RQDLFQEEGVLNMILDTIDKFSQMEALPDFAGLIGEETHVKWEQISTYLYLLVAAMIKGNHYNCAQFASAQRLDWLFGRL
SNPQSAEGILDVLYCVLTESPEALNMINEGHIRSVISLLEKVGRDPKVLDVLSSLCEGNGMAVRSSQNLITQYLLPGKDL
LLQTSMRDHVSSMMPNVMLGVVEGSALFRKWYFEAEVEHIETMTKQTPYLRIGWANSVGFKPFPGSGDKMGCNGVGDDFY
SYGFDGKSMYFGGKSRRVGHKLLEKGDVIGCSIDLTIPEIKFSVNGTYMSGSFKKFNIDGYFFPVMSLSAKVSCRFILGG
NQGRLRYGPPTGFSAVVEAVNGELQITDCLSFGDLGKNIFSGPQTIFNNLEPFIPTPIDVSATQLNHHATEMHQKYAENL
HELWAMRKIELGWSYGETRSETSRKHPCLTKFEYLPETEKKYNILLALTTMKTIEALGYHLITEDPPCRLRAVRLGPNFQ
QQNGYKPGPLDTHEIQLPAELQPLTEALARNTHNIWAKEKIKRGWTFGLSEHVDATQKRSPHLVPYEQVDERIKQANRES
AAENIRALQLFGIFLEPPAHEHDEVAEKELRARKDNTRTYRAEATYAVCGGKWYFEFEILTAGYMKIGWMDIGSTPEIQL
GADDRSYAFDGYLGRKWHQGAETYGKEWKIGDVVGCFLDLNDRTISFSLNGELLLDPSGSEMAFDNVVCGDGLVPAMTLG
SGQRGRLNFGQQSNSLKFFTTCGLQEGYEPFCVNMYRTMPMWFAKQLPRFEDISTLKSGSILEVSRIPATGNSPPCLKIL
QKVTISEGGPSEKAKMEYIKLSLPVKCNDTFVKNKDKETIRRQLQEYKPRSQSVVSQIRAPGIPKEFDDNKEKKGFLRSM
LGSKDSHESDDDRRSRTNSKQPSVDGDEPPAVRRSLLELPHDERQIAEDSMRDLNDRHSEKPKKGGLLSRLRDSSNTRKN
FRDSDRRKEEKAAQLRQMKANSRSFDAGSLDTSTLPTGQKDVLASSEMPLSGPGRQLTIKRSSIKKNKKGKKAEIALEKM
EREKKGSIIPMDAQLDVLQEGDAHALVHHKDKVDEYYYGIRIFPGQDPSQVWVGWVTTQYHYYNVNFDGSQGVRKCRFSE
ADHHGTTVDSVQSQNCYMVNVSELLATTPDVANTKVSGTLIGCIIDTSIGELSFQVGSTDTGIKFKLEPGAMLFPAAFVT
PTATEILQFELGRIKYTFPLSAAMFKSCEKSLVPFCPPRLTVEQIESVYWARVPNETLRTTALKLSEVRGWSVLCNDPVR
IMSVYIPEKDQSLDILEMIEMPDMLEFHRQTLNLYCKLASHGNHKVAHTLCQHIDEDQIMYAIKSHYLSGPMRQGFHDLL
IGLHLMSHTAARNSMAKEYVIPLVPQLQIKNVLDPDSESRYPQITGESVSMLSQMASEPVKKHVSREDEMKLLPPSVDFE
ALKKHVMESLQSATHHAVMNCRDLIGGDNTNHFEPLFKLFDQLLVIGLINDEELECLLRLIHPQAFDENYETGTTQKGLT
QLELAEPVKIQLVSILDHLCDIQLRYRIESLVAFTEGFVGELQSDQCKRYMEIKQTDMPPAEAAKKTKEFRCPPKEQMFR
LLMCKVKEERDPELMEEDADVDQCPMAEGLQQQLRDFCELLVGKIGNVKEGDSDDQLALIESEEGSWVDSFARIVVKVPP
PVLEEGMEMQKKGTQNFREIIVTMLREWAQADFIESKSLIRNMFRLLLRQYSGIREIRDAMSQTYVFHERNEKDVTDFLV
YLIQIRELLTVQFEHTEEAILKRGLWKLMNNRIFFQHPDLMRLLSVHENVMSIMMNILTAQQGTVEHEGDELKEKAPIKD
ASEMVVACSRFLCYFCRTSRQNQKAMFEHLSFLLDNATMLLARPSLRGSVPLDVAYSSFMDNNELALALKEEELDKVAVY
LSRCGLQPNSELITKGYPDIGWDPVEGERYIDFLRFCVWINGENVEENANLVIRLLIRRPECLGVALKGEGQGLFSAFKE
AIALSEDIRLLENDSHPSLLSSGLLGENPTYPSKDAEGEDYIDLGAATLDFYSSLVDLLAKCAPDPMAIQAGKGDSLRAR
AILRSLISLDDLGQILALRFTIPNLAAPSIEDTGPLPGLLPNHKGSVLLFLDRVYGIDQQDMLFHVLEQSFLPDLRAATM
MDSPRALESDTALALNRYLCNSVLPLLTNHSHFFADAEHHSALLDATLHTVYRMNRLKSLTKNQRDAVSDFLVAITRELP
PAMMIKLLKKVITDILTMNDMNVLVPLRLITLHYERCGKYYGSGNHYGVASEQEKRLSMLLFDAIFDTLGSRPYDPELFG
KALPCMTAIGSAISPDYTLTSGLEDVRNKRREEEGAWIPRTVDVSRCEINRDLEKMTELFAEHFHDSWASRKLEKGWVHG
DLYSRANFTHPRLKPFALLKDFEKSFYKERCSECLKALMAWNYSFEMMDRDANDRASAARTLSGTSISNFAPKPIDLSSM
TLEKDMVNAAEKMAEHSHLIWAKKVMNDLNTKGGFMPIPLVPWDLLTDFERRKDRFRASEILKFLQYHGYHVNCPKDEQS
QNDRLKSEGERTSVEKRFAYNLLEKLITYLEQASLKMKSVKPSQELTRRNSFKKEGQDVKFFEKVVLPLMHAYFNAHKNY
FLEGSSIVQTGTASNKEKEMVANLFCRLAALLRIKNRAFGSVAKITVKCLQGLTQALDLRTLVKVNSDIVRTSLLTFFNN
CADDLYASVNELKDGGQYSLIRGQALKSWNSFEFANQMIVPVLTTMFAHLARNHFGTDLLLDDIQAACYKILDSLYMVTG
LSSSISHRKSISGESEKHRPGLGQCLAAFASCFPVAFLEPEFNKSNKFSVLAKSQDQSVQVQEMLQNLSTHIPHLEKLLT
DLETVANNNTMYSDVPNVYDVDLPLMCSYMAHWFSVGPDGKRDKEDQRASVVQTTSVSCDHINRIFNALLKMIRNHVGIE
NAPWLCRVNFFAVQIIQNVTSDPVREFVLPIAERLRRMSEKAYKEEEHMRTHPDDADEGTVAEDNARLVRDTYAFFPILM
KYTDLHRAQWLKTPTWETDGVYENVAVIFRIWSQSQHFKREELNYVAQFEEDAAATGGGDMKTGKAAIAERKKKRREGQD
KMKEYFDRNGRPIIKKDKHAASIVIACLKRLLPVGLNVFGGRELDIVQQSKEKFIQKETEEKIREFIKGLLEIPVKTDPT
DKNAWQLSLYRKIGKSQMRGKDEMSQDAVIEKIFNMGQVSAILHTMTSRMEKEDIWKKVLTLQRKRMAISLITASHLYKT
ELHRGINFFLPAFSRLWMEEEDAGQDQLIADICSGVEEEEGPRIEIIMEEGVPIVASSEDTKEKETNPDPLKQLIRCFQR
AATSEETAASAIHEDSLYIRFADVMAKSIHIEEEDGEDGEEGEIDQAAKEEQSQALRGEQAVLASRGAAIMCLMYLSASG
GEPNEMVAQTLQLGIHLLSGGNVEIQKMLIEYLQLKKDVRFFTSMAGLMNKCSVLNLEMFERQIKAEGLGMGAELASGDN
QNLNDADFTCSLFRFLQLTCEGHNLEFQNYLRTQPGHTTSVNLINCTVDYLLRLQESVMDFYWHYSSKEVIDEGGKEYFL
RAIQVCSQVFNTLTESIQGPCVGNQMTLANSRLWDAINGFFFLFAHMMEKLYKNSTQLELLREFLNLQKDMIVLMLSMLE
GNVLNGSIGKQMVDALVESQPSVEKILKFSDMFLKLKDLTTSQAFQDFDTNQDGWISPKEFQRAMESQKMYTVEDITYLM
MCTDVNNDGKVDYMEFTERFHNPARDIGFNLAVLLVNLKEHITNDPRLEKIIEKAQTLLEYFDPFLGRIEIMGSSKRVEK
IYFEIQESWLEQWGKQQIRDSKNSFLFNVLQDDGGDQGKLEAFINFCEDTIFEMQHAAAISSGDSDTKMERAIKQRDYFL
QQTSADHISETFKSGYNYGISAASALSPQNISTTMRNVSSSVRQMSWTQLLYAVIILFIRAGLAIGWAGYLLLMTIFRFG
YFLTTSSEEEEAARQEKEQAKMNNEHPSFNPPIIQEFHHSHVGVTAFGVGMNADHLNVNSLPDFVPPERPETPETVLEEE
KPLNQETSPPTSPTSPASKAPSIYESIGAPQMVQLQSEADFQQGQYEPKIAESNSTKSRGSILNMLARNFKTIEKITLYL
AFFINVILLFHRVDISHAENAEAASEGDDDEDALESIFITGMQFPYVEYEITGWMLAQILYWISVLHLSTSFALLVSFYQ
LKIPLITFKREKEIARKLMFDGCWITEEDSEELGIVDTFMWYLDRIVVSAKSFPMMYWDKFVRRKTRSKFKDQVDEETLT
SILGEEKMSTDSSYDYRYSCWLWIGVILTNGQFLYRVGYLLCSACGVFLSPFFYAFHLIDVVLSFPMLKAILQSVTHNLQ
QLILTIMMTLVVVYLYTVIAFNFFRKFYVQEGEEGEEPDRKCHNMLTCFIYHFYAGVRAGGGIGDELESPYGDDLEYPRM
FYDISFFFFVIIILLAIMQGLIIDAFGELRDQQESATEKLESSCFICDIGKETFDRMPRGFEIHTTKEHNFANYLFFLQH
LVNKDETEYTGQETYVREKYDNRDWDFFPVGECFVKQYEDQLLQS
Estimated Isoelectric Point:
5.48332977294922
Estimated Molecular Weight:
578.1 kD
Amino Acid Composition:
Amino Acid Frequency
Thr248
Lys308
Gln231
Leu527
Gly303
Met178
Ser361
Tyr154
His130
Glu411
Arg258
Cys89
Phe247
Pro191
Val281
Asn209
Ala320
Ile279
Trp61
Asp299