Sequence:
download
CE51929sequence.fasta
>UNC-52, isoform r MAFSLFSVVSLTVIYRLTINFPELPYTQELKNVESDEFVSTSRDIAHSIQELVKDLEGRHTAKVADYKYHKIIGSLVYVD LYAEKESPLVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSIACATTEFTCLDKSCIPADQRCDGRRNCPDGSDEHKEH GKCKQHQPIIHQTEKVVFAQKHGSIHLSASIDSSVEDNKIAWSKDSVLLGVGSMTLAEDGRVTVYKKGDKHHLHIINATD ADDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQCPDGDDEEHCSEVQCKSNEFR CESTNVCVPTVVVCDGWKDCHDGSDEKKCSHPRKTYKPHHVHHVKVNAVCQDGSEPEFSLHGSSYCWSNKVCPAMTECVA GLCCSISKTRKRQSECLEGQFKCGTGQCIEESLKCNRKYDCADGSDEITCEYYLAVQKYHVEQQRQETQQSSAAAPTRAS AAPAAPASMEHQSDNLVCNDQEFRCPYLAETRCFHYDRLCDGTDDCGDGSDETNCDSNEADQPAAPIPPPVPAPDSVEED VSRCSSVQFECKRDGKCIDKALECNHKYDCEDGSDETECEYFKAAMARRGESTSTSTTTTEQQHQRQHHQAQQAQQHQQQ QERQQQERQQHERQQQERQQQDRQQQAQQHHQAQQHHSQQHPAQPAQPSQDHHEEHRRRLEEHRRREEEHHRRQEEESRA RALQQSLLHASQVESTEVTFQDEYDGDSGVGCLEHEFQCAIGECIDKRRVCDTRPDCLDASDEQNCADRAPAPLPTHSQQ HHHVAQPAAPPSLPSVNTYPDQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSS AHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGE PDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSF HCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTI HDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNC DQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLTFDGT TDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN YEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPG YERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVTQQCS ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTSYGGTLEY TFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLADLDTLLIKSTYN DDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYC LDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDAT KGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLR VRIMEPKRQIALPGDRVHWICQVTGYTTEKIHVEWTKVGEMSLPPNAKAYDGYLVLKGVEAENAGQYRCTATTITQYATD DALLTISKRISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGR YICSAANQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPSGVQEQQGILHI PRASDQEVGQYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKD GRPLPNGILERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPG HPNIQLQFVKRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPIIDPAEQTVPEG SPFKIRCYVPGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPATVHVTNAAAPPQ VEARPPQHPVITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQDAGEYVCLYSP ENSPPVKTNPSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVNQDGDDIVISEA GDRNVGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPNGSPLPHDV TPLEPNILDFSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEV EWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQ GEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSANADD EPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVYRCNVEDNNGLV IGSAFTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFDDASAGTYVCKV SFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDLK EDNAGVYRCVAKTKAGPLQTRTVLNVGSGKRKRKHLGNRRGRRLRHRRRNAQNGPLSRKTRTTTKLFGSWF
view sequence (3271 aa)
>UNC-52, isoform r
MAFSLFSVVSLTVIYRLTINFPELPYTQELKNVESDEFVSTSRDIAHSIQELVKDLEGRHTAKVADYKYHKIIGSLVYVD
LYAEKESPLVSDVLLSAIKSGKIGNLTVSDEGFELHVVRDSSIACATTEFTCLDKSCIPADQRCDGRRNCPDGSDEHKEH
GKCKQHQPIIHQTEKVVFAQKHGSIHLSASIDSSVEDNKIAWSKDSVLLGVGSMTLAEDGRVTVYKKGDKHHLHIINATD
ADDGTYKMIVQGINVEADFEVRITSDRVATESDECPSGERACKSGHCLPVAQFCDRRVQCPDGDDEEHCSEVQCKSNEFR
CESTNVCVPTVVVCDGWKDCHDGSDEKKCSHPRKTYKPHHVHHVKVNAVCQDGSEPEFSLHGSSYCWSNKVCPAMTECVA
GLCCSISKTRKRQSECLEGQFKCGTGQCIEESLKCNRKYDCADGSDEITCEYYLAVQKYHVEQQRQETQQSSAAAPTRAS
AAPAAPASMEHQSDNLVCNDQEFRCPYLAETRCFHYDRLCDGTDDCGDGSDETNCDSNEADQPAAPIPPPVPAPDSVEED
VSRCSSVQFECKRDGKCIDKALECNHKYDCEDGSDETECEYFKAAMARRGESTSTSTTTTEQQHQRQHHQAQQAQQHQQQ
QERQQQERQQHERQQQERQQQDRQQQAQQHHQAQQHHSQQHPAQPAQPSQDHHEEHRRRLEEHRRREEEHHRRQEEESRA
RALQQSLLHASQVESTEVTFQDEYDGDSGVGCLEHEFQCAIGECIDKRRVCDTRPDCLDASDEQNCADRAPAPLPTHSQQ
HHHVAQPAAPPSLPSVNTYPDQDIDSDDDDTSDVQITVFPSEKEVRDGRDVSFECRARTSDNSVYPTVRWARVGGPLPSS
AHDSGGRLTINPVQLSDAGTYICVSDYNGNTVEARATLSVVSYGPQEVSNGLRQAGQCMADEKACGNNECVKNDYVCDGE
PDCRDRSDEANCPAISRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSSSDCKPTEFQCHDRRQCVPSSF
HCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGTTFSLTCKAVAVPEPYINWRLNWGPVCEPPRCLQTSEGGYGTLTI
HDAQPVDQGAYTCEAINVKGRVLATPDCIVRVVDDPRPQPPQPPTAPPQRASCDTRGAVTPYPNNYGTCECKSQVTGPNC
DQCKPGAFHLSEKSPEGCLKCFCFGVSNDCRSSGHYRTKDRLMFAGDAEGVTISDIEERTIDRNTPFSFFKTGYLTFDGT
TDGVAKYWRLPQRFLGDKVTAYGGKMEFEIEFSGSGHHSSEPMVVLKGNQNILVHRVRNQEHVLRSDSPVRITVETYETN
YEQLNGAAATREDLLMVLADLDAFLIRATHVAHQTSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPG
YERSGYGPYLGTCVPIQPRHQQCGPGAVAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPTNPQGCIPCFCSGVTQQCS
ASSYRRTSVSIDYARGDRDQLELTTSDSRQPYSPQTRAELSGQAIEFRSFEEARGQTLYWKLPEKFLGDKVTSYGGTLEY
TFKFSGNGNSDQSADVILRGNDIALQYKHREPFYADRENKVQIKIIETSWQRVDGQQATREHLLMTLADLDTLLIKSTYN
DDCTDSQLLSANLEFAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHASQCDKEYGYC
LDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCDSFGRCLLCEHNTEGTHCERCKKGYYGDAT
KGSPYDCTPCPCPGASDCYLDNEGQVACRICPAGLQGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLR
VRIMEPKRQIALPGDRVHWICQVTGYTTEKIHVEWTKVGEMSLPPNAKAYDGYLVLKGVEAENAGQYRCTATTITQYATD
DALLTISKRISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHREQLGGPLPHGVYQTGNALKIPQSQLHHAGR
YICSAANQYGTGQSPPAVLEVKKPVIPPKVDPIRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGAPLPSGVQEQQGILHI
PRASDQEVGQYVCTATDPSDNTPLQSEPVQLNIRDPAPPQRGAAPQIDPPNQTVNVNDPAQFRCWVPGQPRAQLKWSRKD
GRPLPNGILERDGFLRIDKSQLHDAGEYECTSTEPDGSTQLSPPARLNVNQPQAIQPQVDPPVQTVNEGEPSRIRCWVPG
HPNIQLQFVKRGRRPLPAHARFSQGNLEIPRTLKSDEDEYICIATDPTTNRPVESNPARVIVKSPIRPIIDPAEQTVPEG
SPFKIRCYVPGHPSVQLTFRRVSGQLNEDADENNGLLAVQRAELTDEGDYICTARDPDTGAPIDSTPATVHVTNAAAPPQ
VEARPPQHPVITPQTQTIPEGDPARIQCTVPGNPSAAQHLSFERVDGKGLPFGSSDDRGVLTIPSTQLQDAGEYVCLYSP
ENSPPVKTNPSTLNVTPEGTPPRPVATPPLLSVAPGSPARFNCVAHSDTPARIRWGFREENGPLPEHVNQDGDDIVISEA
GDRNVGEYVCSATNDFGTGVADPVRLEVTEDQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPNGSPLPHDV
TPLEPNILDFSNGRSELNGDYTCTASNPIGEASDHGNVNIGPSLTVKTNPPGPKLIVTVGEPLQVKCEAFGAPGDPEPEV
EWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGVYTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQ
GEKGELICTATGSSLVDRLEWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSANADD
EPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEITKADPSNDFGVYRCNVEDNNGLV
IGSAFTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVPGSKVDWTYENGDLPSKAVPNGNKIEIKEFDDASAGTYVCKV
SFDGNVVEGFVTAQMFVPDTIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDLK
EDNAGVYRCVAKTKAGPLQTRTVLNVGSGKRKRKHLGNRRGRRLRHRRRNAQNGPLSRKTRTTTKLFGSWF
Estimated Isoelectric Point:
5.25208282470703
Estimated Molecular Weight:
359.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr205
Lys131
Gln199
Leu181
Gly245
Met16
Ser226
Tyr88
His102
Glu224
Arg193
Cys155
Phe82
Pro254
Val230
Asn137
Ala216
Ile126
Trp31
Asp230