Sequence:
download
CE51899sequence.fasta
>UNC-2, isoform c MEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQ PVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIE NVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAY FIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIME ARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVF LNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGI SVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALI TVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEE ESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTK YFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCA LFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGK FFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPS PFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIW RLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVG SITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLN AATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLML NLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNM PVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGL LILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTS SGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQNYSHRFGYSRNR GSRYDETEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSH DPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTA VRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYT PRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
view sequence (1911 aa)
>UNC-2, isoform c
MEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQ
PVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIE
NVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAY
FIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIME
ARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVF
LNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGI
SVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALI
TVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEE
ESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTK
YFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCA
LFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGK
FFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPS
PFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIW
RLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVG
SITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLN
AATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLML
NLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNM
PVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGL
LILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTS
SGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQNYSHRFGYSRNR
GSRYDETEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSH
DPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTA
VRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYT
PRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
Estimated Isoelectric Point:
6.21701812744141
Estimated Molecular Weight:
218.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr103
Lys70
Gln92
Leu167
Gly108
Met64
Ser145
Tyr83
His48
Glu122
Arg115
Cys34
Phe127
Pro94
Val122
Asn80
Ala116
Ile115
Trp23
Asp83