Sequence:
download
CE51879sequence.fasta
>UNC-2, isoform f MGNDGDGASGSKPNGSVSRLLPSLDRLQPWMIPIAASEIIPSPIHPRKISINDRLFEIRTPRPGEMIKEAVQMAVWPALP RLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQH LPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDS VDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSE RPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPL IVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRR AANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTC CVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMR ALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQ ILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEE LDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEM MVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAF GFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFC TDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFR VEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVT SPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITD ALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATE INRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFV AVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAE DGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILE NYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGG QRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQNYSHRFGYSRNRGSRY DETEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHDPQY HQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRAR RLPLISTMPTHYESAYQPSSYNQHLNDSYGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYTPRSSQY YEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
view sequence (2065 aa)
>UNC-2, isoform f
MGNDGDGASGSKPNGSVSRLLPSLDRLQPWMIPIAASEIIPSPIHPRKISINDRLFEIRTPRPGEMIKEAVQMAVWPALP
RLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFILLTIIGNCVVLSMEQH
LPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTMLPFSPATQTANQPVDS
VDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFHSACYNERGEIENVSE
RPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTNDSLGSTYNWAYFIPL
IVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDRTTEEEKAAIMEARRR
AANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQIFYWSVITLVFLNTC
CVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVIWAEVYGGSFGISVMR
ALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPYTHFDTFPVALITVFQ
ILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAEEADEKANEIEEESEE
LDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPFRVLIHSIVCTKYFEM
MVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFWNILDGIVVTCALFAF
GFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIFAVIAVQLFNGKFFFC
TDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNSMDTTFEDQGPSPFFR
VEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMPEDKNSTKYRIWRLVT
SPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDGWNRFDFVTVVGSITD
ALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIVGMQVFGNIWLNAATE
INRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFTSFVFLSSFLMLNLFV
AVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYRLAYKHLIRMNMPVAE
DGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQKLTVGKIYAGLLILE
NYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSAQGSLQQMQGTSSGGG
QRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQNYSHRFGYSRNRGSRY
DETEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHDPQY
HQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRAR
RLPLISTMPTHYESAYQPSSYNQHLNDSYGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYTPRSSQY
YEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
Estimated Isoelectric Point:
6.33162689208984
Estimated Molecular Weight:
235.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr108
Lys78
Gln95
Leu178
Gly117
Met68
Ser159
Tyr84
His49
Glu134
Arg127
Cys35
Phe133
Pro108
Val129
Asn87
Ala130
Ile132
Trp26
Asp88