Sequence:
download
CE51857sequence.fasta
>UNC-2, isoform l MTRMKEASRQLPSPSQLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFIL LTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML PFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFH SACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTN DSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDR TTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQ IFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVI WAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAE EADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPF RVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFW NILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIF AVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNS MDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMP EDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDG WNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIV GMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFT SFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYR LAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQ KLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSA QGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQN YSHRFGYSRNRGSRYDETEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNR YNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQD VSEDDDPMPTAVRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPL ISPRSSHSYYTPRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWA IV
view sequence (2002 aa)
>UNC-2, isoform l
MTRMKEASRQLPSPSQLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFIL
LTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML
PFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFH
SACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTN
DSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDR
TTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQ
IFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVI
WAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY
THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAE
EADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPF
RVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFW
NILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIF
AVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNS
MDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMP
EDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDG
WNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIV
GMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFT
SFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYR
LAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQ
KLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSA
QGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQN
YSHRFGYSRNRGSRYDETEHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNR
YNTMEHSRSSHDPQYHQDQQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQD
VSEDDDPMPTAVRARRLPLISTMPTHYESAYQPSSYNQHLNDSYGLGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPL
ISPRSSHSYYTPRSSQYYEIPSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWA
IV
Estimated Isoelectric Point:
6.31902313232422
Estimated Molecular Weight:
228.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr108
Lys76
Gln95
Leu174
Gly112
Met66
Ser154
Tyr84
His48
Glu131
Arg122
Cys35
Phe132
Pro99
Val126
Asn84
Ala125
Ile123
Trp24
Asp84