Sequence:
download
CE51839sequence.fasta
>UNC-2, isoform k MTRMKEASRQLPSPSQLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFIL LTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML PFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFH SACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTN DSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDR TTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQ IFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVI WAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAE EADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPF RVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFW NILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIF AVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNS MDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMP EDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDG WNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIV GMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFT SFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYR LAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQ KLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSA QGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQT EHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHDPQYHQD QQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRARRLP LISTMPTHYESAYQPSSYNQHLNDSYGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYTPRSSQYYEI PSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
view sequence (1982 aa)
>UNC-2, isoform k
MTRMKEASRQLPSPSQLAAEEARREQKAESGTFVRKTTLSSNAPVKEKGPSSLFIFAEDNIIRRNAKAIIEWGPFEYFIL
LTIIGNCVVLSMEQHLPKNDKKALSEWLERTEPYFMGIFCLECVLKVIAFGFALHKGSYLRSGWNIMDFIVVVSGVVTML
PFSPATQTANQPVDSVDLRTLRAVRVLRPLKLVSGIPSLQVVLKSILCAMAPLLQIGLLVLFAIIIFAIIGLEFYSGAFH
SACYNERGEIENVSERPMPCTNKTSPMGVYNCDVKGTTCLQKWIGPNYGITSFDNIGFAMITVFQCITMEGWTTVMYYTN
DSLGSTYNWAYFIPLIVLGSFFMLNLVLGVLSGEFAKERERVENRREFLKLRRQQQIERELNGYLEWILTAEEVILKEDR
TTEEEKAAIMEARRRAANKKLKQASKQQSTETEEDFEEDEDEMEEEYVDEAERKKRGCCHSVGKFIKQLRIQIRIMVKTQ
IFYWSVITLVFLNTCCVASEHYGQPQWFTDFLKYAEFVFLGIFVVEMLLKLFAMGSRTYFASKFNRFDCVVIVGSAAEVI
WAEVYGGSFGISVMRALRLLRIFKLTSYWVSLRNLVRSLMNSMRSIISLLFLLFLFILIFALLGMQLFGGRFNFPTMHPY
THFDTFPVALITVFQILTGEDWNEVMYLAIESQGGIYSGGWPYSIYFIVLVLFGNYTLLNVFLAIAVDNLANAQELTAAE
EADEKANEIEEESEELDEQYQEGDHCTIDMEGKTAGDMCAVARAMDDLDEECEEEESPFGGPKPMVPYSSMFFLSPTNPF
RVLIHSIVCTKYFEMMVMTVICLSSVSLAAEDPVDEENPRNKVLQYMDYCFTGVFACEMLLKLIDQGILLHPGSYCRDFW
NILDGIVVTCALFAFGFAGTEGSAGKNLNTIKSLRVLRVLRPLKTIKRIPKLKAVFDCVVNSLKNVFNILIVYFLFQFIF
AVIAVQLFNGKFFFCTDKNRKFANTCHGQFFVYDNQNDPPRVEQREWRLRPFNYDNTINAMLTLFVVTTGEGWPGIRQNS
MDTTFEDQGPSPFFRVEVALFYVMFFIVFPFFFVNIFVALIIITFQEQGEAELSEGDLDKNQKQCIDFALNARPRSLFMP
EDKNSTKYRIWRLVTSPPFEYFIMTMICCNTLILMMKYYNNPLFYEEILRLFNTALTAVFTVESILKILAFGVRNYFRDG
WNRFDFVTVVGSITDALVTEFGGHFVSLGFLRLFRAARLIRLLQQGYTIRILLWTFVQSFKALPYVCLLIGMLFFIYAIV
GMQVFGNIWLNAATEINRHNNFQSFFNAVILLFRCATGEGWQDIMMAAVQGKDCARAGSAEINFEKGQTCGSNVSYAYFT
SFVFLSSFLMLNLFVAVIMDNFDYLTRDSSILGPHHLDEFIRVWADYDPAATGRIHYSEMYEMLRIMAPPVGFGKKCPYR
LAYKHLIRMNMPVAEDGTVHFTTTLFALIRESLSIKMRPVEEMDEADEELRLTLKKIWPLKAKKNMVDLVVPPNHELCFQ
KLTVGKIYAGLLILENYRARKSGTEVGGQGLFGGGLRSLVAAAKAAESQHSSHTPQPPEETTPIIPQHAQQFSAAPTMSA
QGSLQQMQGTSSGGGQRPYSLFNSFVDTIKSGKQDGDVTDVQYQSVDQQHEKMNSTGRRLSDMFSKIRRGTSADHNPHQT
EHLLAQDNRSPSSPRYRSMARASPPSPAERYGHPPRYRTESPPSSRSEYQMSIRDPIIRRNRYNTMEHSRSSHDPQYHQD
QQQQQQPHHQQHSQHLQHSHHKTYQNHNQYSRSPIYSDDSSVAESYRREREFRRYQDSTPQDVSEDDDPMPTAVRARRLP
LISTMPTHYESAYQPSSYNQHLNDSYGTGYQRDYHTSHSHSHHPTSQQQQHQPMYSTSPLISPRSSHSYYTPRSSQYYEI
PSPSPDIYPSYRGSASPRRYPTSTVVVAPDREGSSARVIQAQPGSIPLSDSETEDDPRWAIV
Estimated Isoelectric Point:
6.24137115478516
Estimated Molecular Weight:
226.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr108
Lys76
Gln95
Leu173
Gly109
Met66
Ser151
Tyr81
His47
Glu130
Arg118
Cys35
Phe131
Pro99
Val126
Asn82
Ala125
Ile123
Trp24
Asp83