Sequence:
download
CE51787sequence.fasta
>KBP-2 MSQRKEVLNQMLDTTLEIFTKSLLESQDLWKMSSHRKLNMDKAAVDAVMARMAKSTQQKVLEKTDQMIKENSVYELFDDM EQLTRESEELNKQLGREMGYNPVNAKRDVALHLSETAEKMLTEADAEIEKIEKELKAEEDEIARRKQVLKELATIVESQQ QKL
view sequence (163 aa)
>KBP-2
MSQRKEVLNQMLDTTLEIFTKSLLESQDLWKMSSHRKLNMDKAAVDAVMARMAKSTQQKVLEKTDQMIKENSVYELFDDM
EQLTRESEELNKQLGREMGYNPVNAKRDVALHLSETAEKMLTEADAEIEKIEKELKAEEDEIARRKQVLKELATIVESQQ
QKL
Estimated Isoelectric Point:
5.08139801025391
Estimated Molecular Weight:
18.9 kD
Amino Acid Composition:
Amino Acid Frequency
Thr9
Lys18
Gln12
Leu19
Gly2
Met10
Ser10
Tyr2
His2
Glu23
Arg8
Phe2
Pro1
Val9
Asn6
Ala13
Ile6
Trp1
Asp10