Sequence:
download
CE51560sequence.fasta
>MAB-3, isoform b MAAQIKLRRSQQKSRDGKEPKRNSRRKSKDMDMEMMVVTATDGQKIIGTSASPSPSSTTDTMSPSLSMSPPCSPSPLLAQ YTLTLAAPIPIYPPIPMNQQLISLQQQQFLMSIIQNMAPSIGQQAPLLPGISAGSVSSAAILNEFWSMYLKNYGLQA
view sequence (157 aa)
>MAB-3, isoform b
MAAQIKLRRSQQKSRDGKEPKRNSRRKSKDMDMEMMVVTATDGQKIIGTSASPSPSSTTDTMSPSLSMSPPCSPSPLLAQ
YTLTLAAPIPIYPPIPMNQQLISLQQQQFLMSIIQNMAPSIGQQAPLLPGISAGSVSSAAILNEFWSMYLKNYGLQA
Estimated Isoelectric Point:
9.72011566162109
Estimated Molecular Weight:
17.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys8
Gln15
Leu14
Gly7
Met11
Ser23
Tyr4
Glu3
Arg6
Cys1
Phe2
Pro16
Val3
Asn5
Ala13
Ile12
Trp1
Asp5