Sequence:
download
CE51542sequence.fasta
>LIN-42, isoform f MGIRSPKHTTVEYYKIAPKLRVIERILVKQVTVDTRGNVLHIIEYFELEGERGTISQMEPAGHSSATHNIVVPNANPTQP QPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYADGFHEQYLTIGDNFLARLEPKGQS FILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHVSSNFHVFTFITKHSSTCALTHID YASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAHNGSILRCQTEWSAYVNPWTRKME LVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKVSSAISSVTFLSSGDGASHRLSSSSVLLVLT LHFYLCASLRRDTRLARRIRRRESGQQRHLSEQKVHMLALRSMAPCQEKECKNDALAGGAVSGTTDELIPRRTFLEFAWN GECNFIGGPVLYGSRRDMVQVLQKPTKLKS
view sequence (510 aa)
>LIN-42, isoform f
MGIRSPKHTTVEYYKIAPKLRVIERILVKQVTVDTRGNVLHIIEYFELEGERGTISQMEPAGHSSATHNIVVPNANPTQP
QPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYADGFHEQYLTIGDNFLARLEPKGQS
FILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHVSSNFHVFTFITKHSSTCALTHID
YASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAHNGSILRCQTEWSAYVNPWTRKME
LVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKVSSAISSVTFLSSGDGASHRLSSSSVLLVLT
LHFYLCASLRRDTRLARRIRRRESGQQRHLSEQKVHMLALRSMAPCQEKECKNDALAGGAVSGTTDELIPRRTFLEFAWN
GECNFIGGPVLYGSRRDMVQVLQKPTKLKS
Estimated Isoelectric Point:
8.92768096923828
Estimated Molecular Weight:
56.4 kD
Amino Acid Composition:
Amino Acid Frequency
Thr35
Lys20
Gln17
Leu54
Gly27
Met10
Ser51
Tyr11
His19
Glu26
Arg36
Cys10
Phe20
Pro27
Val35
Asn16
Ala41
Ile29
Trp4
Asp22