Sequence:
download
CE51451sequence.fasta
>LIN-42, isoform e MELVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKPVPSTSRHSHHHHHSSLKDQNQGFPANID LGAYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKVASAPPTTSTDPPLSYTQINCLENVHRLLKSQS RPESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPPAKRTTPIHWTSSSQNHYRTMA PAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPVFP KTSSSSSLLMLRDSQN
view sequence (336 aa)
>LIN-42, isoform e
MELVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKPVPSTSRHSHHHHHSSLKDQNQGFPANID
LGAYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKVASAPPTTSTDPPLSYTQINCLENVHRLLKSQS
RPESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPPAKRTTPIHWTSSSQNHYRTMA
PAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPVFP
KTSSSSSLLMLRDSQN
Estimated Isoelectric Point:
9.00704193115234
Estimated Molecular Weight:
36.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr30
Lys19
Gln19
Leu24
Gly11
Met6
Ser39
Tyr8
His11
Glu12
Arg17
Cys3
Phe6
Pro37
Val18
Asn13
Ala28
Ile14
Trp2
Asp19