Sequence:
download
CE51377sequence.fasta
>LIN-42, isoform d MGIRSPKHTTVEYYKIAPKLRVIERILVKQVTVDTRGNVLHIIEYFELEGERGTISQMEPAGHSSATHNIVVPNANPTQP QPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYADGFHEQYLTIGDNFLARLEPKGQS FILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHVSSNFHVFTFITKHSSTCALTHID YASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAHNGSILRCQTEWSAYVNPWTRKME LVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKPVPSTSRHSHHHHHSSLKDQNQGFPANIDLG AYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKVASAPPTTSTDPPLSYTQINCLENVHRLLKSQSRP ESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPPAKRTTPIHWTSSSQNHYRTMAPA PPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPVFPKT SSSSSLLMLRDSQN
view sequence (654 aa)
>LIN-42, isoform d
MGIRSPKHTTVEYYKIAPKLRVIERILVKQVTVDTRGNVLHIIEYFELEGERGTISQMEPAGHSSATHNIVVPNANPTQP
QPLAPAMREEGATLSPPNTWSSSSVEFLDDADDNRLLFTCTFTLPHGTVLSSATYADGFHEQYLTIGDNFLARLEPKGQS
FILSAAAASVKQRIFARVTMPDGALRACELLCEFETDRAKITVLALRSAFSLQASHVSSNFHVFTFITKHSSTCALTHID
YASIPYLGLLPTDLIGKSLLAFVYSPDVHVVRQAHIDLHNSRGKIVKSIADLRLVAHNGSILRCQTEWSAYVNPWTRKME
LVVARHRICSLPIGDSDVISSPPPGIQSNTLPPVMAKTFEDELRTIMNKPVPSTSRHSHHHHHSSLKDQNQGFPANIDLG
AYIDKIVEQLVVNSTAQQQQKVAVAAAAAAQAAQAAVVATAQIRKVASAPPTTSTDPPLSYTQINCLENVHRLLKSQSRP
ESPAKQDEPFDEKKYPPQTPLTREALTLHTKRFEDEYKDTWCRRLKRLSDDVPSSPPAKRTTPIHWTSSSQNHYRTMAPA
PPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPVFPKT
SSSSSLLMLRDSQN
Estimated Isoelectric Point:
8.59474945068359
Estimated Molecular Weight:
71.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr55
Lys31
Gln29
Leu56
Gly26
Met10
Ser67
Tyr17
His25
Glu28
Arg35
Cys8
Phe20
Pro54
Val40
Asn24
Ala57
Ile34
Trp5
Asp33