Sequence:
download
CE51338sequence.fasta
>RPY-1 MGVFVCRDNINLITNHRRSMGQRQAKQHMQAGVKLYHQRHYAQAINKWRQSLNRLNNAEDRFITLGYLAQALCDQGEYEG MLSYALSQMQLATDQNDSAMKCEAFLNLAKAYERLADFTKALQYGKASLEHPSMDPRTPGYAHLTIALAHLGMSQFQQCL ESFESAMNVANETSDRLLELQICVGLGSLFTLLRDITKALIFLRNALAIVQSVTVDDVHAKYRCLILYHLSVALRMKGSL VDAKEACDEASQLAVEMGNRAIHARCMCSLADIYRELGESEAKETITKSWARYEDAYRVMRGANDKMGEVLVLSSMAKSA SESRSHYTGQCECQAIQLNKKCIEIANQIGCKHVVLKCHLRLAELYSQLNDDDSEETARRAASRLTQEMQLFCNFCGQRY GLKDESLQALRCSHIFHEKCLHTYLLQRTDQTCPKCRCRAVLSDNISIRSSIASTIDVQSPSTSFAPPGGVATPLVSAAA ELGDITPQATLTRRSQQDKILRGAEKDIDRVDRSLARLKSQQSAAANACSAVAVPSPEVPSTTASCASEPILTASTTSQS HTHSNANHKPPPPPRKPCCSQAALPPSSIVALPPAMPLAEDGPLVITHTPTVTDV
view sequence (615 aa)
>RPY-1
MGVFVCRDNINLITNHRRSMGQRQAKQHMQAGVKLYHQRHYAQAINKWRQSLNRLNNAEDRFITLGYLAQALCDQGEYEG
MLSYALSQMQLATDQNDSAMKCEAFLNLAKAYERLADFTKALQYGKASLEHPSMDPRTPGYAHLTIALAHLGMSQFQQCL
ESFESAMNVANETSDRLLELQICVGLGSLFTLLRDITKALIFLRNALAIVQSVTVDDVHAKYRCLILYHLSVALRMKGSL
VDAKEACDEASQLAVEMGNRAIHARCMCSLADIYRELGESEAKETITKSWARYEDAYRVMRGANDKMGEVLVLSSMAKSA
SESRSHYTGQCECQAIQLNKKCIEIANQIGCKHVVLKCHLRLAELYSQLNDDDSEETARRAASRLTQEMQLFCNFCGQRY
GLKDESLQALRCSHIFHEKCLHTYLLQRTDQTCPKCRCRAVLSDNISIRSSIASTIDVQSPSTSFAPPGGVATPLVSAAA
ELGDITPQATLTRRSQQDKILRGAEKDIDRVDRSLARLKSQQSAAANACSAVAVPSPEVPSTTASCASEPILTASTTSQS
HTHSNANHKPPPPPRKPCCSQAALPPSSIVALPPAMPLAEDGPLVITHTPTVTDV
Estimated Isoelectric Point:
7.93112945556641
Estimated Molecular Weight:
67.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr34
Lys27
Gln38
Leu65
Gly25
Met17
Ser55
Tyr17
His20
Glu33
Arg39
Cys25
Phe12
Pro26
Val29
Asn22
Ala71
Ile28
Trp2
Asp30