Sequence:
download
CE51322sequence.fasta
>LIN-42, isoform g MAPAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPV FPKTSSSSSLLMLRDSQN
view sequence (98 aa)
>LIN-42, isoform g
MAPAPPPPPGKNYQITYTPLDDLTDQKSTNTKSDVENVAYPISGSKFSTPMRLSIDGLLPRGATSTGGASPTSGTNSPPV
FPKTSSSSSLLMLRDSQN
Estimated Isoelectric Point:
8.03302764892578
Estimated Molecular Weight:
10.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr11
Lys5
Gln3
Leu8
Gly7
Met3
Ser16
Tyr3
Glu1
Arg3
Phe2
Pro14
Val3
Asn5
Ala5
Ile3
Asp6