Sequence:
download
CE51188sequence.fasta
>APX-1, isoform e MDDTNIQCKCRRGFSGKFCEIGNHGDCSAMRCSAGETCQISGDFAICVENDELLLTTNKPAETTKSVEKWREPRKTANDE QASDELQLRLIAAICVLFSVCVIGLALVSFFFYMHSFSKWKHPSSQQAGGSTILPTTTSIPMSTTSSGTGSPVYKVCIID SEHRGNAPGSSSDSEPDHHCPPPHRHSPPPAYSSLVLYKKVPMAADDESSFRV
view sequence (213 aa)
>APX-1, isoform e
MDDTNIQCKCRRGFSGKFCEIGNHGDCSAMRCSAGETCQISGDFAICVENDELLLTTNKPAETTKSVEKWREPRKTANDE
QASDELQLRLIAAICVLFSVCVIGLALVSFFFYMHSFSKWKHPSSQQAGGSTILPTTTSIPMSTTSSGTGSPVYKVCIID
SEHRGNAPGSSSDSEPDHHCPPPHRHSPPPAYSSLVLYKKVPMAADDESSFRV
Estimated Isoelectric Point:
6.04644012451172
Estimated Molecular Weight:
23.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys11
Gln6
Leu12
Gly13
Met5
Ser28
Tyr4
His8
Glu12
Arg9
Cys11
Phe9
Pro15
Val11
Asn6
Ala14
Ile11
Trp2
Asp12