Sequence:
download
CE50917sequence.fasta
>NURF-1, isoform m MDEDSEEEEESSDDEFMLNEDQVVQEEEEELNLTDIKIEKGLDEENKYCPWLDEDPASLPKLELPESSQDIPIPTASIMD AVEIYEILRSYHRTLRITPFTFEDFCAALISHNNSCIMAEVHMALLRNCLKSDDEEQTHYSVTETNNSVNIMIHHMDTLT YAEILRQYIEAYPFADASVRDAINVDNYPFVGYDAKLVVLLFMSYRFLYSSEFKKLVNNVGKFQNDENCRVCGKSSGRVV GCTQCEAAFHVECSHLKPFPEVLVCNICKKNSAVRGVLPPDEAVDREPLRSQPIGRDRYGRYYWFIVRRLVVQSLDETEL YYYSTVPQLYQLLQKLDRTYYEKDLCDTIRLRIDEFLEQMALTVEMTSERREAALETMVKRQLIGYDFAEATTPQIYLHR DSMKRMASILRDCAQKGQVKQEVKLEEPVEGQSPVKCVQFVEDSILPESMIGIFDAKLINTFWSGGATQEELVEQFVDIS DNFDAPSANLWRMGDEGNDQTFMTYYNYYSRNEMSESFLTRKKAADKKKYMASKFAQIDNFDWVVAKNRQFYGDASLHCK FIMWTLQQVIKNIPIDLMHRKWPEFAKGFDLEVSVADDYKKLVTCLLKLDCAVRKTIFMPQWWNGLGQTRLERITVDQRE NFMKEQQRLKKIDADALTKDLDDSFVRVNYMKPKWPNTYILRQRGETYRNAGKGSMGGWAWVAAKYVEKWIQVPESPKLP LAVTVEEIKTESVSNRKARRLELLVSKITKKRQRSGGKSSKKPTFELTNGCYSPSCRSNPNRKCYSPMCRNGYLVSAKQA HDERKLEESGVLGEEKAWPIPEIQTFSTKRGGKSIFVLQKKILRQMIMGGGCQQVYMPGFSAGIKSNLLIWPYPAPRPTL DLCWKWQTLNARSLHAVALQLKIIWSSIKFNEFDPDDTHPDRRVVIDTPSHDERRRIIRHKEMPPYGQYERYEMEIEIIP LYDEPEEEDESWLSRNRGGSSEFSHRSSSARKKRPQRSLDNRRATAIRREWVDGVTLKVFEIKDYWKWIRAEAEKTAKRK LEATRKAQKAKEDEERRRIQQQQQRSVARIPVPMHSLIPSERNNVPYLGSQQQRRPNGNERGFLEKYNNSSSVSPQAHGY ASTPPPGYHQPQPNIIRQAGYNQLPRKPTTSPFNFQSRPVATIPTTPQLRAAAGADGVVRAVMMTPGNKSTVNTNSTPYP QALNRQQYQLQRQQQQPAVRRLTNGYHFMDGTMRGGGRNPSVQMHQRLPQNRAALQRPFGESTTEMRRVTEAAIPDNDGD EQPPVIPRYDPTSNFDAQRAQQQHPQSRPVYSTPAQMIRTTQPGGVKHNVILMKASDGTQKMVLKPGQFPPGTVISTGQR VVPYRQPTAVQQRQLYTATPGTRVVRIPNANGGAPRQQDHQVMRRVVQASGPRAMEYMDDQGTPPPGQQVRYVLQGGNSG TPNVNPPKVSSRGGPRGGLTMQMVQQQQQHNPEHRRLLAGRQKQKVTTYRDFMASRGYLDTSKFMMQTKPTFLPFEFNEE EEREINEAIAREEAWMRQEEENKTSGYDSSGNPIRSITSSGDTQRAPPYVSNLLPSSNDSPDDKVIKQVLDVMFSQVCRW DRQYGWSKTHVKRARQKNDSDKMHLRKFRMNQRELLITDHMERLKKEINKRRTRMENEAEQQCGLLTPWRKARARPHRAA KPKAEVKKEVINPADITLGGDTYDYVKEQKPTESIATNVSRRRRTSANLSKSEDDRDKPESQSTAPKSKERRTSEPPASH VAFHTPGSATPHDINLSIEHCTCQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQERVKDQPALY CVCQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACTREAEGYESEASDVSGSSRVSVQLTRADYTHVFE LLELLLEHRMSTPFRNPVDLNEFPDYEKFIKKPMDLSTITKKVERTEYLYLSQFVNDVNQMFENAKTYNPKGNAVFKCAE TMQEVFDKKLIDVREQMTARQQMLLLATAQQQDPMSSIRKRVQSESQRTVDSLDIDSDQLLPLDANLMRLYDF
view sequence (2073 aa)
>NURF-1, isoform m
MDEDSEEEEESSDDEFMLNEDQVVQEEEEELNLTDIKIEKGLDEENKYCPWLDEDPASLPKLELPESSQDIPIPTASIMD
AVEIYEILRSYHRTLRITPFTFEDFCAALISHNNSCIMAEVHMALLRNCLKSDDEEQTHYSVTETNNSVNIMIHHMDTLT
YAEILRQYIEAYPFADASVRDAINVDNYPFVGYDAKLVVLLFMSYRFLYSSEFKKLVNNVGKFQNDENCRVCGKSSGRVV
GCTQCEAAFHVECSHLKPFPEVLVCNICKKNSAVRGVLPPDEAVDREPLRSQPIGRDRYGRYYWFIVRRLVVQSLDETEL
YYYSTVPQLYQLLQKLDRTYYEKDLCDTIRLRIDEFLEQMALTVEMTSERREAALETMVKRQLIGYDFAEATTPQIYLHR
DSMKRMASILRDCAQKGQVKQEVKLEEPVEGQSPVKCVQFVEDSILPESMIGIFDAKLINTFWSGGATQEELVEQFVDIS
DNFDAPSANLWRMGDEGNDQTFMTYYNYYSRNEMSESFLTRKKAADKKKYMASKFAQIDNFDWVVAKNRQFYGDASLHCK
FIMWTLQQVIKNIPIDLMHRKWPEFAKGFDLEVSVADDYKKLVTCLLKLDCAVRKTIFMPQWWNGLGQTRLERITVDQRE
NFMKEQQRLKKIDADALTKDLDDSFVRVNYMKPKWPNTYILRQRGETYRNAGKGSMGGWAWVAAKYVEKWIQVPESPKLP
LAVTVEEIKTESVSNRKARRLELLVSKITKKRQRSGGKSSKKPTFELTNGCYSPSCRSNPNRKCYSPMCRNGYLVSAKQA
HDERKLEESGVLGEEKAWPIPEIQTFSTKRGGKSIFVLQKKILRQMIMGGGCQQVYMPGFSAGIKSNLLIWPYPAPRPTL
DLCWKWQTLNARSLHAVALQLKIIWSSIKFNEFDPDDTHPDRRVVIDTPSHDERRRIIRHKEMPPYGQYERYEMEIEIIP
LYDEPEEEDESWLSRNRGGSSEFSHRSSSARKKRPQRSLDNRRATAIRREWVDGVTLKVFEIKDYWKWIRAEAEKTAKRK
LEATRKAQKAKEDEERRRIQQQQQRSVARIPVPMHSLIPSERNNVPYLGSQQQRRPNGNERGFLEKYNNSSSVSPQAHGY
ASTPPPGYHQPQPNIIRQAGYNQLPRKPTTSPFNFQSRPVATIPTTPQLRAAAGADGVVRAVMMTPGNKSTVNTNSTPYP
QALNRQQYQLQRQQQQPAVRRLTNGYHFMDGTMRGGGRNPSVQMHQRLPQNRAALQRPFGESTTEMRRVTEAAIPDNDGD
EQPPVIPRYDPTSNFDAQRAQQQHPQSRPVYSTPAQMIRTTQPGGVKHNVILMKASDGTQKMVLKPGQFPPGTVISTGQR
VVPYRQPTAVQQRQLYTATPGTRVVRIPNANGGAPRQQDHQVMRRVVQASGPRAMEYMDDQGTPPPGQQVRYVLQGGNSG
TPNVNPPKVSSRGGPRGGLTMQMVQQQQQHNPEHRRLLAGRQKQKVTTYRDFMASRGYLDTSKFMMQTKPTFLPFEFNEE
EEREINEAIAREEAWMRQEEENKTSGYDSSGNPIRSITSSGDTQRAPPYVSNLLPSSNDSPDDKVIKQVLDVMFSQVCRW
DRQYGWSKTHVKRARQKNDSDKMHLRKFRMNQRELLITDHMERLKKEINKRRTRMENEAEQQCGLLTPWRKARARPHRAA
KPKAEVKKEVINPADITLGGDTYDYVKEQKPTESIATNVSRRRRTSANLSKSEDDRDKPESQSTAPKSKERRTSEPPASH
VAFHTPGSATPHDINLSIEHCTCQKIFDASKLYIQCELCARWYHGDCVGVAEQTILGLEHWSCEECIEEQERVKDQPALY
CVCQKPYDDTKFYVGCDSCQGWFHPECVGTTRAEAEQAADYNCPACTREAEGYESEASDVSGSSRVSVQLTRADYTHVFE
LLELLLEHRMSTPFRNPVDLNEFPDYEKFIKKPMDLSTITKKVERTEYLYLSQFVNDVNQMFENAKTYNPKGNAVFKCAE
TMQEVFDKKLIDVREQMTARQQMLLLATAQQQDPMSSIRKRVQSESQRTVDSLDIDSDQLLPLDANLMRLYDF
Estimated Isoelectric Point:
8.27976226806641
Estimated Molecular Weight:
238.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr115
Lys129
Gln138
Leu140
Gly97
Met62
Ser140
Tyr77
His40
Glu160
Arg161
Cys40
Phe66
Pro127
Val125
Asn89
Ala127
Ile92
Trp29
Asp119