Sequence:
download
CE50490sequence.fasta
>CDH-3 MTIRIFFSIFLLNHLIFFHLFNFTHQFSEETIKFSVSEDAKLNTIIGHLEAEIGYTYRLSRGNSKIKFDEQTLELSVSSP LDRESENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDS LATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTLNWNG LPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQNNTECLQRCEFVVEARDSGVPPLSTTLNIVVNM EYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSDGPLGANSTIWIENGNEQSIFSLISRQSINILTVKHVE NANQEQYILEFRANDGQSPADRITRKELKIFFKKYVKSTQIHVERESHVTVEKDTVPGSFVAHVETNCTDMCSFELANSD VFKIDPFNGIIVTSSILPEGVTSYHLPIRIHLPPPSTQLVEADVFVKVIQESVPKNLIRSSESPIHLKRAYTFTTWQDVS LGTVIGRLPKAQIYSTIDTVSELGVFPDGSVFVGKTITSDFVTLPVTLVNRNTTQTSIITLIVKPLNQHSPICQITEIHV LENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTT NCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYHDFFQLDKETGKVTTIQDVPM TWQRLNISISAVNMDSERFLQSKTFLLVTVTSSSKLAVQLNSGNLIRIFKNDKIGEKVGHLDIASSETVYWSTLDPRLHV DSSGNIILIRRNAKQASTGFDIILTSENGEKTEKVNFEVEFVDSERSEDVEKVMDIVLNENTTEVSNLMNDWKNWKISRV ILENANNSGNNTFFLEHKKLWRTKNATVSNAYIILESEDQEGSPKSFKLLHVTTSPSPSSESSCISPAHLISPPSTVPLP SNCSNVKLQNLKTSLQIHENNLLIPTQSELINHVDLVSTQNSDMKPFMMTLIKDYLSEDVRFSTNNVLMLLSSIHPIGTS FGRVTAESGYRIRYYIVGTDKISIDADTGELILKERFYRNLNDILIVAVIPKGIAKAKITIEVIEDRLILPQSNFFIPSP PSFNSKSKIGKIPIDRDDVTIDVIDEHFYVRNFEIFVKRHFIPNSNFYDLKGTVKKGKLSAPISVTLFFGEKMKSREIRE NELMFEIEENSPIGTVVGVVPNSDTTKYRLVDPTCGLLIDQEGIIRTTTVFDRENTSLLKTKMIEPSENRIWNLLIFIAD VNDNKPKILNAPGRIIVYDDLNYKLEWEDLDAIASDVSFSIVDGDVFGNLEIEDSGVISLNSIPNESFNATIRIYDNRPP FKVHFDDVTIEFQVTQKLRAVTCEDAEFWMFFGNEDVGMLIASEIVTWRIVPQIGSDSFKIDPITGIIQSTPNTKPTSDI AKLKIQAISYDGERVGFCDVKIHIDKAAFVENVVLSNGTFEFNISETADRFTEVGKIVILGAGLEGSVFRIQDNDYNFTI SPFDGTIFTNSPLDFENIKTYRFNITAGKSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLD EGQNGLVTYSILSGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSS YFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSK VIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVR VTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKS SLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIARDIDRSSRVFYE IVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRI GEPVIQLSASDADEHSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVNVKDVND NAPIFEKPEYLFISEENSAEIGQFHASDMDSENNGKIRYSVTSPYFKIEPSTGVLSRFRQQLPQPLMSLKVTATDHGVPR LQKTVLAHLVDKSSFGKIKQRRIRETTKVGDVIGKKIDSGATIFPLDVATVTRDGDVVLKKNATQFWILENDTIYEFVKT DAMESTKNENITLNITSDISMYPLQVDGCFENFILVESRNSDNFKVLRNGSLIVFGFSGNQAHLKIQCDDGFWPKQDRKI INLVVNNLDADRNSFPLARQPTIRKSMSLPKTMILNIPFDSPTGTIIWKNLENAVQYMENQKNVNFSNGSKNLILKTPLE ETMQIDIFGQNFERSALTITPNRSLMACPVFQKNFYFFESVANLDSKHPTEIHNFGWSSDEIKGCQIDIFDKTHLFYQNG SSLIFLKPLLPGTYQFSLQIKSQSDSKIRSACHVVVTVIPPTNLTTWNIPSVIFATRNYNIPNLFHLPSGYSLSSDQRTF SLIGSGTGKNISKLSSGVYQVNVVGKDEKKEIVRILLDDVADDVTSKDIEYHVVSSTLSNLKIPTPIDVECFPRTEENLY EITKDCRLLFNSDVINTTIPVVTSPANSTWNLRIINESPETVKSLENNAVSLEIITQKSSIPRLITDLRVTYSDMKIYCL GTWQTSEDIKYHITFVIVDRNGVVIEESEARQTLTSFLKKHRPGYLDFVDFDKDPCDGVTCIQKNSTCQPTLVGDSASRL VSRSSSVIFDLPLKKLTARCFCSSGIDCYDDTTNETIQKTQKINVITTCDDIDCGPRGKCFMEESSQPICRCGQGFESMY SCERADDVFSMSTGGSVEISVRNGTSHLLKCSENCDGRDIQKIEFDFRTVQLEKSELFRVDFGKQVALIELIGGSLTFSI TDAYARPIETRIEKRVNDGRWHRLLFQMSEDGRRISIQVNGRGKEVKSRVPLQMLFTAKKIQLMTPAAFCFRRLLAQNQF VHPILNRNKFFEISSTGTSRNECQFDSIQSGSGGFRLFSNFSNTTTLILLITLALISLIGFSVCLLAIRRRWRQKSPGDQ KQTERSNGWTGHVMPRRRGHINRSMVKSPDDDTYDVATVYGMKSTSTDDITHIYTSSSSRRYQPPTAPSYRRDGHINMAY L
view sequence (3361 aa)
>CDH-3
MTIRIFFSIFLLNHLIFFHLFNFTHQFSEETIKFSVSEDAKLNTIIGHLEAEIGYTYRLSRGNSKIKFDEQTLELSVSSP
LDRESENAIDMLIITSPPSIIHILIDVLDVNDNSPIFPIDVQRVEIPETAPIGWRVQISGATDPDEGKNGTIGKYELVDS
LATVDTMSPFGIVQSDGFLFLEVTGKLDRETRDLYSMRLTAIDQGVPELSSSCHLNILILDINDNPPNFGIRSLTLNWNG
LPNTKLFSLNATDLDSNENSLLTYRILPSGPTSEMFSISDENILVTQNNTECLQRCEFVVEARDSGVPPLSTTLNIVVNM
EYGNEHEPNINIRFYPSDYPFIIVQPEDVNGKTLAILSITDSDGPLGANSTIWIENGNEQSIFSLISRQSINILTVKHVE
NANQEQYILEFRANDGQSPADRITRKELKIFFKKYVKSTQIHVERESHVTVEKDTVPGSFVAHVETNCTDMCSFELANSD
VFKIDPFNGIIVTSSILPEGVTSYHLPIRIHLPPPSTQLVEADVFVKVIQESVPKNLIRSSESPIHLKRAYTFTTWQDVS
LGTVIGRLPKAQIYSTIDTVSELGVFPDGSVFVGKTITSDFVTLPVTLVNRNTTQTSIITLIVKPLNQHSPICQITEIHV
LENAPIGTIFGRIQARDEDSGLSGVVSYKILTKSDDYDGIFHLDSTSGSLRSLKAFDAEKKRSYTFEYEAKDLGTPSKTT
NCPATIFIEDVNDNVPKFGSRYYTATISGKSNETVAIVQANDNDVDVKNQKLQYHLLNYHDFFQLDKETGKVTTIQDVPM
TWQRLNISISAVNMDSERFLQSKTFLLVTVTSSSKLAVQLNSGNLIRIFKNDKIGEKVGHLDIASSETVYWSTLDPRLHV
DSSGNIILIRRNAKQASTGFDIILTSENGEKTEKVNFEVEFVDSERSEDVEKVMDIVLNENTTEVSNLMNDWKNWKISRV
ILENANNSGNNTFFLEHKKLWRTKNATVSNAYIILESEDQEGSPKSFKLLHVTTSPSPSSESSCISPAHLISPPSTVPLP
SNCSNVKLQNLKTSLQIHENNLLIPTQSELINHVDLVSTQNSDMKPFMMTLIKDYLSEDVRFSTNNVLMLLSSIHPIGTS
FGRVTAESGYRIRYYIVGTDKISIDADTGELILKERFYRNLNDILIVAVIPKGIAKAKITIEVIEDRLILPQSNFFIPSP
PSFNSKSKIGKIPIDRDDVTIDVIDEHFYVRNFEIFVKRHFIPNSNFYDLKGTVKKGKLSAPISVTLFFGEKMKSREIRE
NELMFEIEENSPIGTVVGVVPNSDTTKYRLVDPTCGLLIDQEGIIRTTTVFDRENTSLLKTKMIEPSENRIWNLLIFIAD
VNDNKPKILNAPGRIIVYDDLNYKLEWEDLDAIASDVSFSIVDGDVFGNLEIEDSGVISLNSIPNESFNATIRIYDNRPP
FKVHFDDVTIEFQVTQKLRAVTCEDAEFWMFFGNEDVGMLIASEIVTWRIVPQIGSDSFKIDPITGIIQSTPNTKPTSDI
AKLKIQAISYDGERVGFCDVKIHIDKAAFVENVVLSNGTFEFNISETADRFTEVGKIVILGAGLEGSVFRIQDNDYNFTI
SPFDGTIFTNSPLDFENIKTYRFNITAGKSTSQVIIHVTDENDEAPRFITGDVVNLKVLEELDTVSYPLIIGSSIAEDLD
EGQNGLVTYSILSGNTSLFAVNSTTGDILSLIPLDREESSLHELLIEAKDAGIPSLSATSKILIHVGDINDNTPEFELSS
YFIKISENSKIGSKIIRILATDKDKDAELQYSLESNDEITIPFRINVATGWITVAGKVNREENEEFRFFVKVTDGEKSSK
VIVEIHVEDFNDNHPMINDRNSDIFVPDPTRSVEIIHVINVHDLDKSDHLKFSLNNSNLNLSENGEITLKSPLQTAVPVR
VTVSDDAGHVAFMEYLFHPHSRKHFPVFVEKLDTVSVREHDEQELAVFKANGDSIRYSIVSRCSDHLEMEKSTGILKTKS
SLDAEEYSECLVFIIATTYFDNKPLSTITKATIKIVDINDNSPRFDQQLYRFNVTENSGPKLIGHVIARDIDRSSRVFYE
IVGGDANHEFMVTESGQIESVRDLDRETKSEYHLIVEAIDDGKPRRRGNTTVIVTVLDEDDNAPRFSRIFHVEVPEDVRI
GEPVIQLSASDADEHSNHRFELDGGGEGIPFRVDENTGMVFVNDSLDFEKKQSYRIKVKLTDGAWLIETSLFVNVKDVND
NAPIFEKPEYLFISEENSAEIGQFHASDMDSENNGKIRYSVTSPYFKIEPSTGVLSRFRQQLPQPLMSLKVTATDHGVPR
LQKTVLAHLVDKSSFGKIKQRRIRETTKVGDVIGKKIDSGATIFPLDVATVTRDGDVVLKKNATQFWILENDTIYEFVKT
DAMESTKNENITLNITSDISMYPLQVDGCFENFILVESRNSDNFKVLRNGSLIVFGFSGNQAHLKIQCDDGFWPKQDRKI
INLVVNNLDADRNSFPLARQPTIRKSMSLPKTMILNIPFDSPTGTIIWKNLENAVQYMENQKNVNFSNGSKNLILKTPLE
ETMQIDIFGQNFERSALTITPNRSLMACPVFQKNFYFFESVANLDSKHPTEIHNFGWSSDEIKGCQIDIFDKTHLFYQNG
SSLIFLKPLLPGTYQFSLQIKSQSDSKIRSACHVVVTVIPPTNLTTWNIPSVIFATRNYNIPNLFHLPSGYSLSSDQRTF
SLIGSGTGKNISKLSSGVYQVNVVGKDEKKEIVRILLDDVADDVTSKDIEYHVVSSTLSNLKIPTPIDVECFPRTEENLY
EITKDCRLLFNSDVINTTIPVVTSPANSTWNLRIINESPETVKSLENNAVSLEIITQKSSIPRLITDLRVTYSDMKIYCL
GTWQTSEDIKYHITFVIVDRNGVVIEESEARQTLTSFLKKHRPGYLDFVDFDKDPCDGVTCIQKNSTCQPTLVGDSASRL
VSRSSSVIFDLPLKKLTARCFCSSGIDCYDDTTNETIQKTQKINVITTCDDIDCGPRGKCFMEESSQPICRCGQGFESMY
SCERADDVFSMSTGGSVEISVRNGTSHLLKCSENCDGRDIQKIEFDFRTVQLEKSELFRVDFGKQVALIELIGGSLTFSI
TDAYARPIETRIEKRVNDGRWHRLLFQMSEDGRRISIQVNGRGKEVKSRVPLQMLFTAKKIQLMTPAAFCFRRLLAQNQF
VHPILNRNKFFEISSTGTSRNECQFDSIQSGSGGFRLFSNFSNTTTLILLITLALISLIGFSVCLLAIRRRWRQKSPGDQ
KQTERSNGWTGHVMPRRRGHINRSMVKSPDDDTYDVATVYGMKSTSTDDITHIYTSSSSRRYQPPTAPSYRRDGHINMAY
L
Estimated Isoelectric Point:
5.20284271240234
Estimated Molecular Weight:
377.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr243
Lys187
Gln103
Leu266
Gly168
Met45
Ser317
Tyr76
His70
Glu217
Arg157
Cys39
Phe177
Pro147
Val244
Asn213
Ala120
Ile312
Trp25
Asp235