Sequence:
download
CE50386sequence.fasta
>PQN-80, isoform m MAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFEERMKKE QEKQEEKERKEREKREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETEAANA LQGLEEDLLMDDIDFMTQQQTKVDEERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDH SFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQ YNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGG AAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPM SQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQ QQQLQQHQHQIRHQMNTNYPPPPGYNHHGH
view sequence (590 aa)
>PQN-80, isoform m
MAQTLATQKTQNKQCLTQNDYQLLFDYFGKFEKALEQRKAKKEEAERLKKLEEKLKKEKEKQAEKDRIEAKKFEERMKKE
QEKQEEKERKEREKREEKERKEREIREIMERKKREEDDRIAAKLQIAQQLENDRKMREAEESARKETERRAKMETEAANA
LQGLEEDLLMDDIDFMTQQQTKVDEERKVAEARRAVERENQIKMMRAQQLQRRQEEAPPPQQAPAPHTQKIQVKNEPVDH
SFDILKEAEKDAHIIPTKSIKAEPLDVQKPLSAFEKLASLRGRTQSADMRRGGDSTEMPNVTQQYQAEQNHLAQSSNNSQ
YNAPSTSSQPQHFPTEPSIRQPPPQQSYNSNQMLQNPRQQPQNQIVQNFQSAPQRHPHQNPQIATSSSSGGVNQFYNNGG
AAPPVVEQQAANRRSSFTMSHSVQQHQSPLQQQFPINSYQSPSHHNNSSSMSNSSLMQTPHSNSSMIARSPQFPSHTSPM
SQRFHTPPSVGHQMVQSPLSQPNPSPLQHFNFSPHSSSFSSQRPQMPPQRQMSQQNLMHQQQQPQNHTQHQYQHQTFSSQ
QQQLQQHQHQIRHQMNTNYPPPPGYNHHGH
Estimated Isoelectric Point:
9.21553802490234
Estimated Molecular Weight:
68.6 kD
Amino Acid Composition:
Amino Acid Frequency
Thr23
Lys42
Gln91
Leu28
Gly12
Met22
Ser55
Tyr10
His27
Glu55
Arg39
Cys1
Phe18
Pro46
Val14
Asn33
Ala39
Ile18
Asp17