Sequence:
download
CE50157sequence.fasta
>GLD-2, isoform f MKAMRSFQFHNWPQMSHGSYYPMPYHLENQMRPMKSGDQLPLNQQNHNLSGFPAFVGKSSLVGSSLNTRNSSEADPEEMP RIMEKLDDEVTGADHDKTIDENRRRIHKSQEPRIGTEEKALNELPRKANRRNSSCSSISSVSESSSPSALDESTLTKILP TDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYHNKVSQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNG FGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQYEKFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRN THLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSYSLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLN VTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDAISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSA STSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPFTNSNTAHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECE PIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRVLNSIPVSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRG FNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNENVRDSSRQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRK DDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
view sequence (754 aa)
>GLD-2, isoform f
MKAMRSFQFHNWPQMSHGSYYPMPYHLENQMRPMKSGDQLPLNQQNHNLSGFPAFVGKSSLVGSSLNTRNSSEADPEEMP
RIMEKLDDEVTGADHDKTIDENRRRIHKSQEPRIGTEEKALNELPRKANRRNSSCSSISSVSESSSPSALDESTLTKILP
TDNFRGGRGFASPSPPTSLLSEPLSRMDVLSEKIWDYHNKVSQTDEMLQRKLHLRDMLYTAISPVFPLSGLYVVGSSLNG
FGNNSSDMDLCLMITNKDLDQKNDAVVVLNLILSTLQYEKFVESQKLILAKVPILRINFAAPFDDITVDLNANNSVAIRN
THLLCYYSSYDWRVRPLVSVVKEWAKRKGINDANKSSFTSYSLVLMVIHFLQCGPTKVLPNLQQSYPNRFSNKVDVRTLN
VTMALEEVADDIDQSLSEKTTLGELLIGFLDYYANEFNYDRDAISIRQGRRVERAALAVRPKIHSNSEGDKETPPPSSSA
STSSIHNGGTPGIPMHHSISNPHFWRSQWRCVCIEEPFTNSNTAHSIYDEMVFEAIKKAFREAHGELQHNHDLDKLMECE
PIKASTTNTGAAVFAATYEGERPLAQQPNTIACASLRVLNSIPVSSGPGHYHYQQQSNQNLSRPQRPGSNQGYQMNNNRG
FNGNNQQQHQNRRSFNNQSSSNPGNGSTGPRSSRSNENVRDSSRQQNSQKGSSGVSVSKENVASTTGVPVDKKQQNSNRK
DDGNRTKRSPMVQSPEPAKTKSEKTPMASSNVSQ
Estimated Isoelectric Point:
8.65605926513672
Estimated Molecular Weight:
84.2 kD
Amino Acid Composition:
Amino Acid Frequency
Thr36
Lys39
Gln40
Leu57
Gly39
Met21
Ser96
Tyr20
His22
Glu41
Arg46
Cys8
Phe23
Pro46
Val42
Asn63
Ala40
Ile31
Trp6
Asp38