Sequence:
download
CE50070sequence.fasta
>C30G4.4, isoform m MSSGGSRFKQSESPINMLITHREMKCDMKSEPSLKVVPVETRDPYFSPNGKHAIAKPTAAIKNIHPSSSPSVVQPTSGIP VQQRPASHLIAPNPKPVYTVPKVAPTAQVKASTIIQPTVNGQVKVSSETQISTGVMVAEANQSRRTKSVAASPPAHNVLN IDNKIEQAMDLVKTHLMFAVREEVDGLRGKIFDLENHVRRLEAENSILKRTIPNDTLKQLHLKL
view sequence (224 aa)
>C30G4.4, isoform m
MSSGGSRFKQSESPINMLITHREMKCDMKSEPSLKVVPVETRDPYFSPNGKHAIAKPTAAIKNIHPSSSPSVVQPTSGIP
VQQRPASHLIAPNPKPVYTVPKVAPTAQVKASTIIQPTVNGQVKVSSETQISTGVMVAEANQSRRTKSVAASPPAHNVLN
IDNKIEQAMDLVKTHLMFAVREEVDGLRGKIFDLENHVRRLEAENSILKRTIPNDTLKQLHLKL
Estimated Isoelectric Point:
9.82917022705078
Estimated Molecular Weight:
24.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr14
Lys18
Gln11
Leu14
Gly8
Met7
Ser22
Tyr2
His8
Glu12
Arg11
Cys1
Phe4
Pro20
Val21
Asn12
Ala17
Ile15
Asp7