Sequence:
download
CE50045sequence.fasta
>Y105C5B.17 MLLRNLLFLFVIFVSLSDAKKLATSTKEQTIMINIINTIRQKEAMERKISNMHELVFDEELAKKEFQECSWDKDHFINVK DANNFAAIWSYNHSGPFLQMNFRYFINPVQTKIGCSNVQCKGKNFKTFACIMGPEFNQLDFEVRKGEPGEHCPAGRTEMK MCTSEAATFTGYALILIAILNFFWNI
view sequence (186 aa)
>Y105C5B.17
MLLRNLLFLFVIFVSLSDAKKLATSTKEQTIMINIINTIRQKEAMERKISNMHELVFDEELAKKEFQECSWDKDHFINVK
DANNFAAIWSYNHSGPFLQMNFRYFINPVQTKIGCSNVQCKGKNFKTFACIMGPEFNQLDFEVRKGEPGEHCPAGRTEMK
MCTSEAATFTGYALILIAILNFFWNI
Estimated Isoelectric Point:
7.60375213623047
Estimated Molecular Weight:
21.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr10
Lys15
Gln7
Leu14
Gly8
Met8
Ser9
Tyr3
His4
Glu14
Arg6
Cys6
Phe17
Pro5
Val7
Asn15
Ala13
Ile16
Trp3
Asp6