Sequence:
download
CE49989sequence.fasta
>IFTA-1 MPPMLNVMANYNEKTIGKLTMSVFRKFNLGLPEHGQLHFAEWNYNSNYIACGGALGKLKVVKIGTDATDLNKSPNAATLV VNQALEGHNATVMNATWNENNQKLTTSDTSGLIIVWGMFNEQWCEEMINNRNKSVVVSICWNLEGTKIAIAYADGNVIVG TLEGNRIWNKELEIQLAACEWAPDGDMLIFGTADGKVSVFDDSGSHFLDIPMHCLEAEDLEQALAKKEHQKEEIVCLKYW SPTLKSKTILDEMERDFERKLEKDREVTGTAIFTNFPTKPPPKELPEHEKNTEPYQPVPPDRPRFVVAYARGMMQLMRSL NDPEPVVVSIPNFKITGAKWSPNGAFLAVCGNDSDKDEPTFSKIHFLSAYGHIVGYFQTNDSCITGICWESTGLRMAIAA AGTLLIGQIRPEFKWGSIEETIVYVYQKEELYQYGIMFYDYKTDEKTVKTVTHFENMAFYREHCVLINRQDDGVIPHYFC QLCNSIGTSLDYNVTTVRPKFACVNGICAVIASEDRYFIWHFVLPKFNSVQAGIHVPGKSGDYVLEEQQRTIEYGTKRLL GSKDEICALCIGDTFFMMALLSGGIYRVSLNDGVITNSYPVSPSINSIKLNCTFTRLAVIKLVEQVPFQFLLYEFDGDEL KLIYTSDKRDVWDYEWDQNNSNMLALKDKQKILICDGNSILEQSSVNGSILLFQNLVVTAVNIEKILLTPENPTKTCIVE VMIKAKQDVMNLVNAMKLEEAIDYAERSPHSELWSMIANYAVFKHAFDCAEHAFVKLGDYAGVQLVKKLRNIQSNDLRNA EIYAYRDTLEEAKTAFLQADRRDLAVEMYKKVGDYASVYDLIRNDDDDEGKCDAFRNMAETHYEMMEWEEAAKAYSYCGD TANQIDCLIRGNLFGELEVLARTLSDDSEFMEVMGDAFTSRGMCDQAVECYLRRSLPQKALHACKELNQWQKAQFIADAN HMENVEGLLGKFAVEMRGESDEKSLSALALYMRAGRHLDAAKIAFDIAKDRKSKYVPYEELKQCYVLGAVLVENHRQTIK ELRKIDKHNFLEDALDDESGLSAEQSRILENTWRGAEAFHFMIMAQQHFFENRIKDALQTSLILSDYEEFLDPAEVHSMI ALAAANVNQFGICSKAMMRLEAFEEFDDAEKEEMRNLSFRLFSENPPVNPNSAKVACSVCDAKIDPYDLQCSECQTKFPV CIASGRLILDNIFWLCPRCKHRAHQHEIPKYNCCPLCHDMESFRVP
view sequence (1246 aa)
>IFTA-1
MPPMLNVMANYNEKTIGKLTMSVFRKFNLGLPEHGQLHFAEWNYNSNYIACGGALGKLKVVKIGTDATDLNKSPNAATLV
VNQALEGHNATVMNATWNENNQKLTTSDTSGLIIVWGMFNEQWCEEMINNRNKSVVVSICWNLEGTKIAIAYADGNVIVG
TLEGNRIWNKELEIQLAACEWAPDGDMLIFGTADGKVSVFDDSGSHFLDIPMHCLEAEDLEQALAKKEHQKEEIVCLKYW
SPTLKSKTILDEMERDFERKLEKDREVTGTAIFTNFPTKPPPKELPEHEKNTEPYQPVPPDRPRFVVAYARGMMQLMRSL
NDPEPVVVSIPNFKITGAKWSPNGAFLAVCGNDSDKDEPTFSKIHFLSAYGHIVGYFQTNDSCITGICWESTGLRMAIAA
AGTLLIGQIRPEFKWGSIEETIVYVYQKEELYQYGIMFYDYKTDEKTVKTVTHFENMAFYREHCVLINRQDDGVIPHYFC
QLCNSIGTSLDYNVTTVRPKFACVNGICAVIASEDRYFIWHFVLPKFNSVQAGIHVPGKSGDYVLEEQQRTIEYGTKRLL
GSKDEICALCIGDTFFMMALLSGGIYRVSLNDGVITNSYPVSPSINSIKLNCTFTRLAVIKLVEQVPFQFLLYEFDGDEL
KLIYTSDKRDVWDYEWDQNNSNMLALKDKQKILICDGNSILEQSSVNGSILLFQNLVVTAVNIEKILLTPENPTKTCIVE
VMIKAKQDVMNLVNAMKLEEAIDYAERSPHSELWSMIANYAVFKHAFDCAEHAFVKLGDYAGVQLVKKLRNIQSNDLRNA
EIYAYRDTLEEAKTAFLQADRRDLAVEMYKKVGDYASVYDLIRNDDDDEGKCDAFRNMAETHYEMMEWEEAAKAYSYCGD
TANQIDCLIRGNLFGELEVLARTLSDDSEFMEVMGDAFTSRGMCDQAVECYLRRSLPQKALHACKELNQWQKAQFIADAN
HMENVEGLLGKFAVEMRGESDEKSLSALALYMRAGRHLDAAKIAFDIAKDRKSKYVPYEELKQCYVLGAVLVENHRQTIK
ELRKIDKHNFLEDALDDESGLSAEQSRILENTWRGAEAFHFMIMAQQHFFENRIKDALQTSLILSDYEEFLDPAEVHSMI
ALAAANVNQFGICSKAMMRLEAFEEFDDAEKEEMRNLSFRLFSENPPVNPNSAKVACSVCDAKIDPYDLQCSECQTKFPV
CIASGRLILDNIFWLCPRCKHRAHQHEIPKYNCCPLCHDMESFRVP
Estimated Isoelectric Point:
5.12508392333984
Estimated Molecular Weight:
141.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr55
Lys79
Gln44
Leu108
Gly64
Met40
Ser67
Tyr45
His30
Glu101
Arg50
Cys38
Phe57
Pro45
Val77
Asn73
Ala100
Ile76
Trp19
Asp78