Sequence:
download
CE49973sequence.fasta
>UNC-22, isoform h MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLRKTTTSTKNESSTVEEKTKLRK TVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPFAKDGLPEQPANPFAQLKKVKS GAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTESGIKTEFKMEKRERTTLQKYEK TDSDGSKKEHHKEVEEKSTSEELKAKVAGRQVGQKRNGAQKPEEPKNLLSQIQLKKVTKKAHDDTNELEGIKLKKVTTVP KHVADDDSQSESESRRGSVFGELRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEV PENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSA DVKLLVTSDNGLDFRAMLKHSNQQRANSKRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKWDIPLPEK TVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTCEANGVPTHAQLTVLE PPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTLTIKEVEEDDQAEWTAR ITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNRKRRLIINGA RIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFETQSRN GTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKN GKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVW GTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPLTGESVLAKNPYGVPGK PKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVEDKEYLYRVKAVNKAGP GDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVGRVKMSSERGKHIMKIE NAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGK YIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPH KDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHD NLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDVGEYRLTVKNSHGADEE KANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQ FRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECG KVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPP PKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDR ADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEGESDPLTTNTAILAKNP YEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVPNLKEGEEYQFRISARN KAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISRF ALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKD GIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPL SDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDR DALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDE ATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKVAGDKTTAVVDGLIPGH EYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWN DVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGE PTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIV KDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIA KDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELTATVDGLKPGQTYQFRV KALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNNT DNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVE KQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLE WKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMA PKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEH GKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVP GKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAI WTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIKIKAGFTHNLEVDFIGA PDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVT KDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVL AKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEY RVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDS QTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQE VGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWN PPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCRPYVEK PGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNS AGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIV ITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPG GDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPT SDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKIN MGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSELTDGGLYFVELENSQGS DSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIK DNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSKIIGYQVQYRDTSSGRW INAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLE DGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIV VKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTA TANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGR YEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKD MNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYI VEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEV GRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRIKTKP RVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENS VGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRA GKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFDIWKQYYPQPVEIKHDH VLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMIYE FMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVK VTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDSAFSGISEDGKDFIRKL LLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNYSSLRKHRPQEYSIRDA FWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYT VRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQKNHQCKLTCSLQGNPN PTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKGGEPIPRVSSFRPRRAY DTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSAEFSAAVSGQPEPLIEW LHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLLNGHAGQAVESELRVTK HLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGHYQLEVRSKGTNLVSVA SLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGNTFKLDIKNVEQDDDGI YVAKVVKEKKAIAKYAAALLLV
view sequence (7142 aa)
>UNC-22, isoform h
MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK
CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI
FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS
MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP
STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ
WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR
KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS
GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLRKTTTSTKNESSTVEEKTKLRK
TVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPFAKDGLPEQPANPFAQLKKVKS
GAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTESGIKTEFKMEKRERTTLQKYEK
TDSDGSKKEHHKEVEEKSTSEELKAKVAGRQVGQKRNGAQKPEEPKNLLSQIQLKKVTKKAHDDTNELEGIKLKKVTTVP
KHVADDDSQSESESRRGSVFGELRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEV
PENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSA
DVKLLVTSDNGLDFRAMLKHSNQQRANSKRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKWDIPLPEK
TVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTCEANGVPTHAQLTVLE
PPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTLTIKEVEEDDQAEWTAR
ITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNRKRRLIINGA
RIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFETQSRN
GTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKN
GKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVW
GTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPLTGESVLAKNPYGVPGK
PKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVEDKEYLYRVKAVNKAGP
GDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVGRVKMSSERGKHIMKIE
NAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGK
YIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPH
KDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHD
NLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDVGEYRLTVKNSHGADEE
KANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQ
FRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECG
KVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPP
PKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDR
ADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEGESDPLTTNTAILAKNP
YEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVPNLKEGEEYQFRISARN
KAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISRF
ALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKD
GIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPL
SDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDR
DALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDE
ATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKVAGDKTTAVVDGLIPGH
EYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWN
DVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGE
PTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIV
KDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIA
KDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELTATVDGLKPGQTYQFRV
KALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNNT
DNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVE
KQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLE
WKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMA
PKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEH
GKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVP
GKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAI
WTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIKIKAGFTHNLEVDFIGA
PDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVT
KDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVL
AKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEY
RVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDS
QTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQE
VGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWN
PPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCRPYVEK
PGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNS
AGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIV
ITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPG
GDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPT
SDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKIN
MGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSELTDGGLYFVELENSQGS
DSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIK
DNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSKIIGYQVQYRDTSSGRW
INAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLE
DGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIV
VKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTA
TANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGR
YEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKD
MNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYI
VEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEV
GRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRIKTKP
RVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENS
VGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRA
GKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFDIWKQYYPQPVEIKHDH
VLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMIYE
FMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVK
VTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDSAFSGISEDGKDFIRKL
LLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNYSSLRKHRPQEYSIRDA
FWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYT
VRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQKNHQCKLTCSLQGNPN
PTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKGGEPIPRVSSFRPRRAY
DTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSAEFSAAVSGQPEPLIEW
LHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLLNGHAGQAVESELRVTK
HLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGHYQLEVRSKGTNLVSVA
SLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGNTFKLDIKNVEQDDDGI
YVAKVVKEKKAIAKYAAALLLV
Estimated Isoelectric Point:
5.79169464111328
Estimated Molecular Weight:
787.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr486
Lys602
Gln191
Leu394
Gly577
Met71
Ser476
Tyr183
His119
Glu566
Arg380
Cys70
Phe185
Pro514
Val538
Asn313
Ala483
Ile357
Trp115
Asp522