Sequence:
download
CE49956sequence.fasta
>UNC-22, isoform i MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLRKTTTSTKNESSTVEEKTKLRK TVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPFAKDGLPEQPANPFAQLKKVKS GAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTESGIKTEFKMEKRERTTLQKYEK TDSDGSKKEHHKEVEEKSTSEELKAKVAGRQVGQKRNGAQKPEEPKNLLSQIQLKKVTKKAHDDTNELEGIKLKKVTTVP KHVADDDSQSESESRRGSVFGELRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEV PENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSA DVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKI CEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLN PLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKV QVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYK CTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGK IEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMR KLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGA PVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDV DKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKP IKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGK FTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDP NTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEE YIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKA GATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDR PSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKE GASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNA EILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNE KPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPE DDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDK PELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSD PSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISRFALPKALRKQ SGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRS GDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEE YQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIK AGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVID KPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAV NAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQ TNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTF EGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWK EPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADK PGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELTATVDGLKPGQTYQFRVKALNKAGES TPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTK STARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWV PCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGG APIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLL DLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNV TVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVK AVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPG TTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTV GDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWK PPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPG KPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAG PGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPST RRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKV PGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSP ILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRV GKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKP SDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRS DAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHP VGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQG YVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDIL AYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKV VDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVR AETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSE QCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGY NVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQP YNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAP PVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDS GEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLF ENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHD EWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECE ISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYH GGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVN VTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRII AENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHE ELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFE KVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFA APEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRM TIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQP RFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGT KEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDG HPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDV ERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISE SDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNN GESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKA DPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEK KAIAKYAAALLLV
view sequence (7133 aa)
>UNC-22, isoform i
MVGAPRFTQKPSIQQTPTGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTLTPLGGSLYKATLVIKEPNAGDGGAYK
CTARNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRIIPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAI
FSDLGDQTYLCQLEIRGPSSSDAGQYRCNIRNDQGETNANLALNFEEPDPSERQERKRSTASPRPSSRGPGSRPSSPKKS
MKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEVSQSESRRSSRTDKMEVDQVSGASKRKPDGLPPPGGDEKKLRAGSP
STRKSPSRKSASPTPSRKGSSAGGAASGTTGASASATSATSGGSASSDASRDKYTRPPIVLEASRSQTGRIGGSVVLEVQ
WQCHSSTIIEWYRDGTLVRNSSEYSQSFNGSIAKLQVNKLTEEKSGLYKCHAKCDYGEGQSSAMVKIEQSDVEEELMKHR
KDAEDEYQKEEQKSQTLQAETKKRVARRSKSKSKSPAPQAKKSTTSESGRQEASEVEHKRSSSVRPDPDEESQLDEIPSS
GLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSPPKQDDMFSRDTLLRKTTTSTKNESSTVEEKTKLRK
TVKKVDGELDFKAMVKLKKVKKEEGGTTEKSGFPLDHADSTSSVLSQESRSRRGSNAPFAKDGLPEQPANPFAQLKKVKS
GAGGLEKSDSMASLKKLDLKKGKIDDNSDGAFKVQLKKVVKKEVKESTISVKEKNGTESGIKTEFKMEKRERTTLQKYEK
TDSDGSKKEHHKEVEEKSTSEELKAKVAGRQVGQKRNGAQKPEEPKNLLSQIQLKKVTKKAHDDTNELEGIKLKKVTTVP
KHVADDDSQSESESRRGSVFGELRRGSRAPRDSADNSRRDSIRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEV
PENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRFKHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSA
DVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGGEKKPMTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKI
CEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTLIINNPEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLN
PLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDPRFIIEKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKV
QVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVWWHDGKRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYK
CTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGK
IEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIEAKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMR
KLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGA
PVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKFRVKALNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDV
DKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKP
IKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPECLWVVNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGK
FTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGATLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDP
NTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEE
YIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRAVNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKA
GATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNEHTILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDR
PSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKE
GASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNA
EILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNE
KPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPE
DDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPGHEYKFRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDK
PELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSD
PSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGEPAPDVTWSFNGKGIGESKAQIENEPYISRFALPKALRKQ
SGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRS
GDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEE
YQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVVAVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIK
AGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPEYQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVID
KPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEKYDTASGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAV
NAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQ
TNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTF
EGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWK
EPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDLTQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADK
PGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVTVGAGELTATVDGLKPGQTYQFRVKALNKAGES
TPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVNVEGEPAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTK
STARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWV
PCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGG
APIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLL
DLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADVTNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNV
TVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHYIVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVK
AVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPG
TTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKARYLKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTV
GDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKNELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWK
PPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPG
KPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAKTGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAG
PGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVITIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPST
RRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPAVSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKV
PGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSP
ILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETYQFRVRAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRV
GKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKP
SDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRS
DAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHP
VGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQG
YVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDIL
AYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEYSDFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKV
VDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVR
AETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTWAELEWDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSE
QCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKSRFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGY
NVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQP
YNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDGVYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAP
PVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEIDMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDS
GEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLF
ENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLNLEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHD
EWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDLAELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECE
ISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYH
GGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFSITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVN
VTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNYTIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRII
AENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRGKGTVSSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHE
ELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKEIQTMSVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFE
KVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFA
APEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDETLRNVKSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRM
TIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDAWPEPLPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQP
RFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGT
KEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRSAPFFTFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDG
HPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLGVDVSECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDV
ERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFTAQLSDSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISE
SDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQTRATLTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNN
GESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETLSFTINSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKA
DPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEKIEKNERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEK
KAIAKYAAALLLV
Estimated Isoelectric Point:
5.77759552001953
Estimated Molecular Weight:
786.3 kD
Amino Acid Composition:
Amino Acid Frequency
Thr486
Lys601
Gln189
Leu394
Gly577
Met71
Ser474
Tyr183
His119
Glu566
Arg379
Cys70
Phe185
Pro514
Val538
Asn311
Ala482
Ile357
Trp115
Asp522