Sequence:
download
CE49955sequence.fasta
>EPS-8, isoform m MEELLRMQQQQQQKQRKPPVEEPVYQPQPAQRAGLEIWRRNQNPQLIQEVTETVGQHSGDILRPAMQRATRVAINEKSSP EDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDELKAILNHRRTHV ELSNEAAADEPVFTINPIL
view sequence (179 aa)
>EPS-8, isoform m
MEELLRMQQQQQQKQRKPPVEEPVYQPQPAQRAGLEIWRRNQNPQLIQEVTETVGQHSGDILRPAMQRATRVAINEKSSP
EDVTRWLQEKGFSPRVIDLLDGQDGANLFSLSKLHLQQACGRDEGGYLYSQLLVQKKRSGFRTHTGDELKAILNHRRTHV
ELSNEAAADEPVFTINPIL
Estimated Isoelectric Point:
6.97986602783203
Estimated Molecular Weight:
20.5 kD
Amino Acid Composition:
Amino Acid Frequency
Thr8
Lys8
Gln21
Leu19
Gly11
Met3
Ser9
Tyr3
His5
Glu15
Arg15
Cys1
Phe4
Pro11
Val10
Asn7
Ala11
Ile8
Trp2
Asp8