Sequence:
download
CE49926sequence.fasta
>UNC-22, isoform d MNYTPGSYLQNLLKKSASNDGSDHGASPSSSTSSSSRRLPPRPPLESSHSASSPSSSNGGPRRMFNLRSASDRQGASRPT GGQTPNPLNMRSANSSGQDLHKISQIHAFILSKMPEGEAKERFLRSILDLEGPDSRRGSRDDVGSPNMLKKTNSKSSVNS SSNESQLDEIPSSGLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDDKPKKVSIAPVSTNKSSDDEPSTP RRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRF KHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGG EKKPMTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTL IINNPEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDP RFIIEKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVW WHDGKRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQT KDTKTPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIE AKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAP FELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKF RVKALNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQT KPDCCELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPE CLWVVNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGA TLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIK DPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRA VNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNE HTILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKL DTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEW EPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLK PWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASG SDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPG HEYKFRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEE ALVVPGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGE PAPDVTWSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFE DRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAK NPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVV AVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPE YQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEK YDTASGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVD LEWKPPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARN VPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAEN ENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDL TQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSG DWVPAVTVGAGELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVN VEGEPAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLR HKDITKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDH AIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETY QFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADV TNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHY IVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDR IDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKAR YLKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKN ELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPK LTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAK TGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVI TIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPA VSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPV VIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETY QFRVRAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRC NDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGN PKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQ ADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAK NPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRV AAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEY SDFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVE KLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTW AELEWDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKS RFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVV AINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDG VYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEI DMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVT DGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLN LEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDL AELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLT SDDADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFS ITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNY TIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRG KGTVSSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKE IQTMSVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPE NIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDET LRNVKSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDA WPEPLPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELK QSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRS APFFTFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLG VDVSECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFT AQLSDSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQ TRATLTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETL SFTINSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEK IEKNERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
view sequence (6452 aa)
>UNC-22, isoform d
MNYTPGSYLQNLLKKSASNDGSDHGASPSSSTSSSSRRLPPRPPLESSHSASSPSSSNGGPRRMFNLRSASDRQGASRPT
GGQTPNPLNMRSANSSGQDLHKISQIHAFILSKMPEGEAKERFLRSILDLEGPDSRRGSRDDVGSPNMLKKTNSKSSVNS
SSNESQLDEIPSSGLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDDKPKKVSIAPVSTNKSSDDEPSTP
RRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETAILTCKVSGSPAPTFRWFKGSREVISGGRF
KHITDGKEHTVALALLKCRSQDEGPYTLTIENVHGTDSADVKLLVTSDNGLDFRAMLKHRESQAGFQKDGEGGGAGGGGG
EKKPMTEAERRQSLFPGKKVEKWDIPLPEKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIFSGGLKYKIVIEKNVCTL
IINNPEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLNPLPNTQEIYRTKQAVLTCKVNTPRAPLVWYRGSKAIQEGDP
RFIIEKDAVGRCTLTIKEVEEDDQAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESDLATLETDVNDKDAEVVW
WHDGKRIDIDGVKFKVESSNRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFIVALKDTEVIEKDDVTLMCQT
KDTKTPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGKIEMNEADVYEIDQAGLRGSCNVTVLEAEKRPILNWKPKKIE
AKAGEPCVVKVPFQIKGTRRGDPKAQILKNGKPIDEEMRKLVEVIIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAP
FELFVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWAKVGETKGTDFKVKDLKEHGEYKF
RVKALNECGLSDPLTGESVLAKNPYGVPGKPKNMDAIDVDKDHCTLAWEPPEEDGGAPITGYIIERREKSEKDWHQVGQT
KPDCCELTDKKVVEDKEYLYRVKAVNKAGPGDPCDHGKPIKMKAKKASPEFTGGGIKDLRLKVGETIKYDVPISGEPLPE
CLWVVNGKPLKAVGRVKMSSERGKHIMKIENAVRADSGKFTITLKNSSGSCDSTATVTVVGRPTPPKGPLDIADVCADGA
TLSWNPPDDDGGDPLTGYIVEAQDMDNKGKYIEVGKVDPNTTTLKVNGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIK
DPWDEPGKPGRPEITDFDADRIDIAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASISGLKEGKEYQFRVRA
VNKAGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGNQQLENGIQLTIDTRKNE
HTILCIPSAMRSDVGEYRLTVKNSHGADEEKANLTVLDRPSKPNGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKL
DTATGRWVPCAKVKDTKAHIDGLKKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEW
EPPKSDGGAPITQYVIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAVNKAGPGEASDPSRKVVAKPRNLK
PWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWIFNEKPVDDQKIRIESEDYKTRFVLRGATRKHAGLYTLTATNASG
SDKHSVEVIVLGKPSSPLGPLEVSNVYEDRADLEWKVPEDDGGAPIDHYEIEKMDLATGRWVPCGRSETTKTTVPNLQPG
HEYKFRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKDHVDLAWNAPDDGGAPIEAFVIEKKDKNGRWEE
ALVVPGDQKTATVPNLKEGEEYQFRISARNKAGTGDPSDPSDRVVAKPRNLAPRIHREDLSDTTVKVGATLKFIVHIDGE
PAPDVTWSFNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNINGTDSVTINIKVKSKPTKPKGPIEVTDVFE
DRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDSLNKGDHYKFRVKAVNSEGPSDPLETETDILAK
NPFDRPDRPGRPEPTDWDSDHVDLKWDPPLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTTATVPDLTPNEEYEFRVV
AVNKGGPSDPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREIRNGGRVKLDNPE
YQSKLVVKQMERGDSGTFTIKAVNANGEDEATVKINVIDKPTSPNGPLDVSDVHGDHVTLNWRAPDDDGGIPIENYVIEK
YDTASGRWVPAAKVAGDKTTAVVDGLIPGHEYKFRVAAVNAEGESDPLETFGTTLAKDPFDKPGKTNAPEITDWDKDHVD
LEWKPPANDGGAPIEEYVVEMKDEFSPFWNDVAHVPAGQTNATVGNLKEGSKYEFRIRAKNKAGLGDPSDSASAVAKARN
VPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPTPTITWTFEGTPVESDDRMKLNNEDGKTKFHVKRALRSDTGTYIIKAEN
ENGTDTAEVKVTVLDHPSSPRGPLDVTNIVKDGCDLAWKEPEDDGGAEISHYVIEKQDAATGRWTACGESKDTNFHVDDL
TQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDHADLKWTPPADDGGAPIEGYLVEMRTPSG
DWVPAVTVGAGELTATVDGLKPGQTYQFRVKALNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRVKAGQTLNFDVN
VEGEPAPKIEWFLNGSPLSSGGNTHIDNNTDNNTKLTTKSTARADSGKYKIVATNESGKDEHEVDVNILDIPGAPEGPLR
HKDITKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVNKLSEGHEYKFRVKAVNRQGTSAPLTSDH
AIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWKPPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETY
QFRVKAVNKAGPGKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDIAFEGEPAPVAKWKANDATIDTGARADV
TNTPTSSAIHIFSAVRGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPLKIDEIHKEGCTLNWKPPTDNGGTDVLHY
IVEKMDTSRGTWQEVGTFPDCTAKVNKLVPGKEYAFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDR
IDIKWNPTANNGGAPVTGYIVEKKEKGSAIWTEAGKTPGTTFSADNLKPGVEYEFRVIAVNAAGPSDPSDPTDPQITKAR
YLKPKILTASRKIKIKAGFTHNLEVDFIGAPDPTATWTVGDSGAALAPELLVDAKSSTTSIFFPSAKRADSGNYKLKVKN
ELGEDEAIFEVIVQDRPSAPEGPLEVSDVTKDSCVLNWKPPKDDGGAEISNYVVEKRDTKTNTWVPVSAFVTGTSITVPK
LTEGHEYEFRVMAENTFGRSDSLNTDEPVLAKDPFGTPGKPGRPEIVDTDNDHIDIKWDPPRDNGGSPVDHYDIERKDAK
TGRWIKVNTSPVQGTAFSDTRVQKGHTYEYRVVAVNKAGPGQPSDSSAAATAKPMHEAPKFDLDLDGKEFRVKAGEPLVI
TIPFTASPQPDISWTKEGGKPLAGVETTDSQTKLVIPSTRRSDSGPVKIKAVNPYGEAEANIKITVIDKPGAPENITYPA
VSRHTCTLNWDAPKDDGGAEIAGYKIEYQEVGSQIWDKVPGLISGTAYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPV
VIKDPFDPPGAPSTPEITGYDTNQVSLAWNPPRDDGGSPILGYVVERFEKRGGGDWAPVKMPMVKGTECIVPGLHENETY
QFRVRAVNAAGHGEPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELTWNRPLRDGGAPIDGYIVEKKKLGDNDWTRC
NDKPVRDTAFEVKNLGEKEEYEFRVIAVNSAGEGEPSKPSDLVLIEEQPGRPIFDINNLKDITVRAGETIQIRIPYAGGN
PKPIIDLFNGNSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKPTGPIRATDIQ
ADAMTLSWRPPKDNGGDAITNYVVEKRTPGGDWVTVGHPVGTTLRVRNLDANTPYEFRVRAENQYGVGEPLETDDAIVAK
NPFDTPGAPGQPEAVETSEEAITLQWTRPTSDGGAPIQGYVIEKREVGSTEWTKAAFGNILDTKHRVTGLTPKKTYEFRV
AAYNAAGQGEYSVNSVPITADNAPTRPKINMGMLTRDILAYAGERAKILVPFAASPAPKVTFSKGENKISPTDPRVKVEY
SDFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVDKPASPQHIRVEDIAPDCCTLYWMPPSSDGGSPITNYIVE
KLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNRYRFRVRAETQYGVSEPCELADVVVAKYQFEVPNQPEAPTVRDKDSTW
AELEWDPPRDGGSKIIGYQVQYRDTSSGRWINAKMDLSEQCHARVTGLRQNGEFEFRIIAKNAAGFSKPSPPSERCQLKS
RFGPPGPPIHVGAKSIGRNHCTITWMAPLEDGGSKITGYNVEIREYGSTLWTVASDYNVREPEFTVDKLREFNDYEFRVV
AINAAGKGIPSLPSGPIKIQESGGSRPQIVVKPEDTAQPYNRRAVFTCEAVGRPEPTARWLRNGRELPESSRYRFEASDG
VYKFTIKEVWDIDAGEYTVEVSNPYGSDTATANLVVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSLVLNREEI
DMDHPTIRIVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGLPEAPQGPLHISNIGPSTATLSWRPPVT
DGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNYIVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIIARLPFDPPTSPLN
LEIVQVGGDYVTLSWQRPLSDGGGRLRGYIVEKQEEEHDEWFRCNQNPSPPNNYNVPNLIDGRKYRYRVFAVNDAGLSDL
AELDQTLFQASGSGEGPKIVSPLSDLNEEVGRCVTFECEISGSPRPEYRWFKGCKELVDTSKYTLINKGDKQVLIINDLT
SDDADEYTCRATNSSGTRSTRANLRIKTKPRVFIPPKYHGGYEAQKGETIELKIPYKAYPQGEARWTKDGEKIENNSKFS
ITTDDKFATLRISNASREDYGEYRVVVENSVGSDSGTVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDGGSLVTNY
TIEKREAMGGSWSPCAKSRYTYTTIEGLRAGKQYEFRIIAENKHGQSKPCEPTAPVLIPGDERKRRRGYDVDEQGKIVRG
KGTVSSNYDNYVFDIWKQYYPQPVEIKHDHVLDHYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHESDKETVRKE
IQTMSVLRHPTLVNLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPE
NIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSVGVLSYILLSGLSPFGGENDDET
LRNVKSCDWNMDDSAFSGISEDGKDFIRKLLLADPNTRMTIHQALEHPWLTPGNAPGRDSQIPSSRYTKIRDSIKTKYDA
WPEPLPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVGEGQSANFYCRVIASSPPVVTWHKDDRELK
QSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNSYGTKEEIVFLNVTRHSEPLKFEPLEPMKKAPSPPRVEEFKERRS
APFFTFHLRNRLIQKNHQCKLTCSLQGNPNPTIEWMKDGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTATNDLG
VDVSECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRDVSPDVRSAADDLKTKITNELPSFT
AQLSDSETEVGGSAEFSAAVSGQPEPLIEWLHNGERISESDSRFRASYVAGKATLRISDAKKSDEGQYLCRASNSAGQEQ
TRATLTVKGDQPLLNGHAGQAVESELRVTKHLGGEIVNNGESVTFEARVQGTPEEVLWMRNGQELTNGDKTSISQDGETL
SFTINSADASDAGHYQLEVRSKGTNLVSVASLVVVGEKADPPVTRLPSSVSAPLGGSTAFTIEFENVEGLTVQWFRGSEK
IEKNERVKSVKTGNTFKLDIKNVEQDDDGIYVAKVVKEKKAIAKYAAALLLV
Estimated Isoelectric Point:
5.51708221435547
Estimated Molecular Weight:
711.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr439
Lys512
Gln155
Leu354
Gly520
Met63
Ser403
Tyr173
His111
Glu500
Arg336
Cys62
Phe174
Pro482
Val498
Asn299
Ala434
Ile340
Trp111
Asp486