Sequence:
download
CE49604sequence.fasta
>MAB-20, isoform c MRPEIRVLDSLSLRDQQEPRTEIGICVVDPTFNFTAVVVDSGNPEDATSVYSGIRTGMGGENHLIYRPPLTKNGKQLHAS IRTIYSDNKWLNEPQFVGSFDVGQHVFFFFREIAHDNSFGERIVHSRVARVCKKDIGGRNVLRQVWTSFVKARLNCSVSA NFPFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAICMFQLSSINHLLDTGLLMEETANGQFSVTADEIPAHRPGTC SQNSHSISDTDLHFAKTHLLVSDSISGGTPILPLRDHVFTHIVVDQLPNQNVIFAFDSANRRVWKISHWKEGNEWKSNLI EEKSLKIAASRINDVALLPAEFFFVTSGAGVSQFSVARCSEQPSCALCSLDPYCSWNAVNSKCSLKTKTNEKSVGWISSS WAGRISPECSAVEKLTVKDVYLGDGLRLVGAKNGVWQKDGRSVESGQRHVVTRNGELVVLDAQLEDAGTYECLRDNIILV RARIVVHENCARPTSVAEYRSCQREWCKKADAYKAALNIWSDSNKKNVQCKANTSSAH
view sequence (538 aa)
>MAB-20, isoform c
MRPEIRVLDSLSLRDQQEPRTEIGICVVDPTFNFTAVVVDSGNPEDATSVYSGIRTGMGGENHLIYRPPLTKNGKQLHAS
IRTIYSDNKWLNEPQFVGSFDVGQHVFFFFREIAHDNSFGERIVHSRVARVCKKDIGGRNVLRQVWTSFVKARLNCSVSA
NFPFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAICMFQLSSINHLLDTGLLMEETANGQFSVTADEIPAHRPGTC
SQNSHSISDTDLHFAKTHLLVSDSISGGTPILPLRDHVFTHIVVDQLPNQNVIFAFDSANRRVWKISHWKEGNEWKSNLI
EEKSLKIAASRINDVALLPAEFFFVTSGAGVSQFSVARCSEQPSCALCSLDPYCSWNAVNSKCSLKTKTNEKSVGWISSS
WAGRISPECSAVEKLTVKDVYLGDGLRLVGAKNGVWQKDGRSVESGQRHVVTRNGELVVLDAQLEDAGTYECLRDNIILV
RARIVVHENCARPTSVAEYRSCQREWCKKADAYKAALNIWSDSNKKNVQCKANTSSAH
Estimated Isoelectric Point:
7.86202239990234
Estimated Molecular Weight:
60.0 kD
Amino Acid Composition:
Amino Acid Frequency
Thr29
Lys28
Gln19
Leu37
Gly31
Met4
Ser56
Tyr11
His18
Glu29
Arg32
Cys16
Phe26
Pro18
Val47
Asn30
Ala38
Ile29
Trp11
Asp29