Sequence:
download
CE49534sequence.fasta
>MAB-20, isoform d MGGENHLIYRPPLTKNGKQLHASIRTIYSDNKWLNEPQFVGSFDVGQHVFFFFREIAHDNSFGERIVHSRVARVCKKDIG GRNVLRQVWTSFVKARLNCSVSANFPFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAICMFQLSSINHLLDTGLLM EETANGQFSVTADEIPAHRPGTCSQNSHSISDTDLHFAKTHLLVSDSISGGTPILPLRDHVFTHIVVDQLPNQNVIFAFD SANRRVWKISHWKEGNEWKSNLIEEKSLKIAASRINDVALLPAEFFFVTSGAGVSQFSVARCSEQPSCALCSLDPYCSWN AVNSKCSLKTKTNEKSVGWISSSWAGRISPECSAVEKLTVKDVYLGDGLRLVGAKNGVWQKDGRSVESGQRHVVTRNGEL VVLDAQLEDAGTYECLRDNIILVRARIVVHENCARPTSVAEYRSCQREWCKKADAYKAALNIWSDSNKKNVQCKANTSSA H
view sequence (481 aa)
>MAB-20, isoform d
MGGENHLIYRPPLTKNGKQLHASIRTIYSDNKWLNEPQFVGSFDVGQHVFFFFREIAHDNSFGERIVHSRVARVCKKDIG
GRNVLRQVWTSFVKARLNCSVSANFPFYFDHIQSVKRVDKHGETYFYATFSTSETAFTSSAICMFQLSSINHLLDTGLLM
EETANGQFSVTADEIPAHRPGTCSQNSHSISDTDLHFAKTHLLVSDSISGGTPILPLRDHVFTHIVVDQLPNQNVIFAFD
SANRRVWKISHWKEGNEWKSNLIEEKSLKIAASRINDVALLPAEFFFVTSGAGVSQFSVARCSEQPSCALCSLDPYCSWN
AVNSKCSLKTKTNEKSVGWISSSWAGRISPECSAVEKLTVKDVYLGDGLRLVGAKNGVWQKDGRSVESGQRHVVTRNGEL
VVLDAQLEDAGTYECLRDNIILVRARIVVHENCARPTSVAEYRSCQREWCKKADAYKAALNIWSDSNKKNVQCKANTSSA
H
Estimated Isoelectric Point:
8.53333282470703
Estimated Molecular Weight:
53.8 kD
Amino Acid Composition:
Amino Acid Frequency
Thr24
Lys28
Gln17
Leu34
Gly27
Met3
Ser51
Tyr10
His18
Glu25
Arg27
Cys15
Phe24
Pro14
Val40
Asn28
Ala36
Ile25
Trp11
Asp24