Sequence:
download
CE49372sequence.fasta
>ELO-5 MMDQILGTNFTYEGAKEVARGLEGFSAKLAVGYIATIFGLKYYMKDRKAFDLSTPLNIWNGILSTFSLLGFLFTFPTLLS VIRKDGFSHTYSHVSELYTDSTSGYWIFLWVISKIPELLDTVFIVLRKRPLIFMHWYHHALTGYYALVCYHEDAVHMVWV VWMNYIIHAFMYGYYLLKSLKVPIPPSVAQAITTSQMVQFAVAIFAQVHVSYKHYVEGVEGLAYSFRGTAIGFFMLTTYF YLWIQFYKEHYLKNGGKKYNLAKDQAKTQTKKAN
view sequence (274 aa)
>ELO-5
MMDQILGTNFTYEGAKEVARGLEGFSAKLAVGYIATIFGLKYYMKDRKAFDLSTPLNIWNGILSTFSLLGFLFTFPTLLS
VIRKDGFSHTYSHVSELYTDSTSGYWIFLWVISKIPELLDTVFIVLRKRPLIFMHWYHHALTGYYALVCYHEDAVHMVWV
VWMNYIIHAFMYGYYLLKSLKVPIPPSVAQAITTSQMVQFAVAIFAQVHVSYKHYVEGVEGLAYSFRGTAIGFFMLTTYF
YLWIQFYKEHYLKNGGKKYNLAKDQAKTQTKKAN
Estimated Isoelectric Point:
9.25153350830078
Estimated Molecular Weight:
31.7 kD
Amino Acid Composition:
Amino Acid Frequency
Thr19
Lys19
Gln8
Leu28
Gly18
Met9
Ser16
Tyr23
His11
Glu9
Arg6
Cys1
Phe20
Pro7
Val20
Asn7
Ala20
Ile18
Trp7
Asp8